KEGG   Streptococcus suis ST3: SSUST3_1050Help
Entry
SSUST3_1050       CDS       T01470                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sst  Streptococcus suis ST3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSUST3_1050 (glgB)
Enzymes [BR:sst01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SSUST3_1050 (glgB)
Exosome [BR:sst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSUST3_1050 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055409..1057247
Genome map
AA seq 612 aa AA seqDB search
MTEFTDLDLYYMNAGEHTTLYEKMGAHIIKERNKIIGTQFRVYAPNAREVFLVGNFNEWQ
RSHSMEREIDGVFQLYVDGLKSLEDYKYLIITHDGREIYKADPYAFFSQVRPDTASTTYN
SRYKFKDDLWMYNRVNYDFKEQPVSIYEVHLGSWKQKFANKNEGGAPVEAFNSYKEITPL
LIEHIKENNYTHIELLPITEHPLDASWGYQVTGYYSPTSRYGKPDELKYLVDQCHQAGIG
VILDWVPLHFCKDAHGLYQFDGSWLYEYSYEQDRENHQWGTANFDLGKGLTRSFLLSNLK
YWLEYFHFDGIRVDALSYLLYWRGETDEDKINHAAIDFIKRVNAMVHTDYKGVLMIAEDS
SSFPKVTHSLEDGGIGFDMKWDLGWMNDTLKFVERPAIYRKYHSNEITFGMYYNQNEQFL
LPLSHDEVVHGKHSIIEKMNGDYEDKFHLARVYYSFYFAHPGKKLLFMGNEWGHIREWHE
YTEMDWGLLQFPIHHSFYQMMKTLSTFYKEHDAFWKYDYQAYEKGFNWVKIDEEASLYAF
SRTSDVQEILTIHNFNDQELFDVHLDLPADSEYKLVFSSNAIPMDTFSLYPDENGARITV
PRLTSFYLERVK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatttactgacctagatttatattatatgaatgctggtgagcataccactctt
tacgaaaaaatgggtgctcatattataaaagaacgaaacaaaattatcggaacccaattt
cgtgtctatgccccaaatgccagagaagtattcttagttggcaactttaacgagtggcaa
cgcagtcactctatggagcgtgaaattgatggagtatttcaactttatgtagacggatta
aaatcccttgaagattataaatacctgattatcacacacgatgggcgtgaaatatataag
gctgacccttatgcatttttcagccaagttcgtccagacactgcctctacaacctacaat
tcgcgttataaattcaaagatgacctctggatgtataatcgtgttaactatgattttaaa
gaacagccagtatccatctacgaggtgcacttaggttcgtggaagcaaaaatttgctaat
aaaaatgaaggaggagctcctgtagaagctttcaatagttataaggaaattactccactt
ctcatcgaacatatcaaggaaaataactacacacatattgagttattgccaattaccgag
catcctctcgatgcgtcttggggctatcaggtaacaggctactacagtccaactagtcgc
tatggcaagccagatgaacttaagtatttagttgaccaatgtcaccaagcaggaatcgga
gtgattcttgactgggtaccacttcatttctgtaaagatgctcatgggctctaccagttt
gatggtagttggctatacgaatactcctacgaacaagaccgtgaaaaccaccagtggggg
actgctaattttgaccttggaaaaggactgactcgttctttccttctttctaatttaaaa
tactggttggaatatttccattttgatggcatccgtgttgatgcactatcttatctcctc
tattggcgtggtgaaacagatgaggataagataaatcatgccgcaattgactttatcaaa
cgtgtcaatgccatggtccataccgactataagggagtcctgatgattgctgaagactct
tcaagcttccctaaagtcacacattctctagaagatggcggtattggatttgatatgaaa
tgggatctgggctggatgaatgatacactaaaattcgtggaacgccctgctatttatcga
aaatatcactcaaatgaaatcacttttggtatgtactataaccaaaacgagcaattctta
ctaccactttcgcacgacgaagttgttcatgggaagcactccattatcgagaagatgaat
ggcgactacgaagataagttccatctggctcgagtctactacagcttttactttgcccat
cctggaaagaaattactcttcatgggaaatgaatggggtcacatccgtgaatggcacgaa
tatacagaaatggactggggactgctacaatttccaatccaccattctttctatcaaatg
atgaaaacactatctactttctataaagaacatgatgctttctggaaatatgactaccaa
gcctatgaaaaaggatttaattgggtaaaaatagatgaagaagcaagcctgtatgctttt
tctcgcactagtgatgtgcaagaaatattgactattcataactttaatgatcaagaacta
tttgatgtacacttggatttgccagctgacagcgaatataaacttgtcttctcatctaat
gctattccaatggacacatttagcctctatcccgatgaaaatggagccagaattactgta
ccacgtttgaccagtttttatctagagcgtgtgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system