KEGG   Streptococcus suis ST3: SSUST3_1282Help
Entry
SSUST3_1282       CDS       T01470                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sst  Streptococcus suis ST3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSUST3_1282 (pfk)
   01230 Biosynthesis of amino acids
    SSUST3_1282 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUST3_1282 (pfk)
   00030 Pentose phosphate pathway
    SSUST3_1282 (pfk)
   00051 Fructose and mannose metabolism
    SSUST3_1282 (pfk)
   00052 Galactose metabolism
    SSUST3_1282 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SSUST3_1282 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SSUST3_1282 (pfk)
Enzymes [BR:sst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSUST3_1282 (pfk)
Protein phosphatases and associated proteins [BR:sst01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSUST3_1282 (pfk)
Messenger RNA biogenesis [BR:sst03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SSUST3_1282 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1288859..1289869)
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMVAGDIHELSARSVGDI
ISRGGTFLGSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRHAGDIALWA
GIASGADVIVVPEEDFNINDIVDRIKAGYDNGKKHSIIVLAEGVMPAAQFAEELKAAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGRGGLAVGIRNEQMVENPILGT
AEEGALFSLTTDGKIVVNNPHKADLELADLNRNLSI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggtgatgcccctggtatgaacgctgctatt
cgtgcagttgttcgccaagcaatttcagaaggaatggaagtttatggaatcaacgaaggt
tacgcaggtatggttgcgggtgatatccatgaattgtctgcacgttctgtaggtgatatt
atttcacgtggaggaacattccttggttcagctcgttatccagaatttgccaaattagaa
gggcaacttaaagggattgagcaattgaaaaaacatggtatcgaaggtgtagtggttatc
ggtggtgacggttcttaccacggagcaatgcgcttgacggagcatggtttcccagctatt
ggtgtacctggtaccattgacaacgacatcgtggggacagattttacaatcggttttgac
acagctgtaacaactgccatggatgcgattgataagattcgcgatacttcatcaagtcac
cgtcgtactttcgtcattgaagtaatgggacgtcatgcaggagacatcgctctttgggct
ggtattgcttctggtgcagatgttatcgttgttccagaagaagacttcaatatcaacgat
attgttgaccgtattaaagcgggctacgacaatggtaagaaacatagcatcattgttttg
gctgaaggtgttatgccagctgcacagttcgctgaagaattgaaagcagcaggcgataca
agtgatcttcgtgtgacagaacttggtcatatccaacgtggtggttctccaacagcgcgt
gatcgtgtactcgcttctcgtatgggtgctcatgccgttaaattgcttaaagaaggccgt
ggaggtcttgcagtaggtatccgtaacgagcaaatggttgaaaatccaattcttggaact
gcagaagaaggtgccttgtttagcttgactactgatggcaagattgtagttaataatccg
cataaagcagatttggagttggctgatttgaaccgtaacttgtcaatctag

DBGET integrated database retrieval system