KEGG   Streptococcus suis ST3: SSUST3_1486Help
Entry
SSUST3_1486       CDS       T01470                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sst  Streptococcus suis ST3
Pathway
sst00071  Fatty acid degradation
sst00072  Synthesis and degradation of ketone bodies
sst00280  Valine, leucine and isoleucine degradation
sst00362  Benzoate degradation
sst00380  Tryptophan metabolism
sst00620  Pyruvate metabolism
sst00630  Glyoxylate and dicarboxylate metabolism
sst00640  Propanoate metabolism
sst00650  Butanoate metabolism
sst00900  Terpenoid backbone biosynthesis
sst01100  Metabolic pathways
sst01110  Biosynthesis of secondary metabolites
sst01120  Microbial metabolism in diverse environments
sst01130  Biosynthesis of antibiotics
sst01200  Carbon metabolism
sst01212  Fatty acid metabolism
sst02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUST3_1486 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SSUST3_1486 (atoB)
   00640 Propanoate metabolism
    SSUST3_1486 (atoB)
   00650 Butanoate metabolism
    SSUST3_1486 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    SSUST3_1486 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SSUST3_1486 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSUST3_1486 (atoB)
   00310 Lysine degradation
    SSUST3_1486 (atoB)
   00380 Tryptophan metabolism
    SSUST3_1486 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSUST3_1486 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSUST3_1486 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SSUST3_1486 (atoB)
Enzymes [BR:sst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSUST3_1486 (atoB)
Exosome [BR:sst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSUST3_1486 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEB81905
Position
1483961..1485145
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALANKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHVSLEDSMLTDGLTDAFNDYHMGITAENVAERYHVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKEGTV
TAANASGINDGCAVLVLMSDEKASELNIQPLAYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctaat
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctagctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagccggtttggtagtaaatttggtcatgttagtctggaa
gattccatgttaacagatggtttgacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacgctatcatgtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcaaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggaaggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttggtactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcgcctatattgaggcctatgcaacaagc
ggtttagatcctgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaatgaagcattcgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatagcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaaattaa

DBGET integrated database retrieval system