KEGG   Streptococcus suis ST3: SSUST3_1550Help
Entry
SSUST3_1550       CDS       T01470                                 

Definition
RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
Orthology
K02428  
dITP/XTP pyrophosphatase [EC:3.6.1.19]
Organism
sst  Streptococcus suis ST3
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sst00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sst00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1539908..1540918)
Genome map
AA seq 336 aa AA seqDB search
MTDKIYEYRDEHNWFIGKASFANLFGSFGENGREQEIYQIGQLFDKLIAGNYEDENFNQC
VNIEVIKLQSEFALFQFACDTLNELNNRQFKVLQHQGAILVTENDKLLLVHLPQAGVSTA
DFFGQDKGLASVGDTILIATKNEGKTKEFRKFFERFGYQVENLNNYPDLPDVAETGMTFE
ENARLKAETIAELTGKMVLADDSGLKVDALGGLPGVWSARFSGPDATDELNNAKLLHELA
MVFELKDRSAQFHCTLVMAAPNRDSLVVEADWEGFIGMDLRGEDGFGYDPLFLVGETGKT
SAELTLEEKNKISHRAQALEKLVEAFPVWQEQAKQS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaagatatacgaatacagagatgaacacaattggtttatcggaaaagccagc
tttgccaatctatttggttcatttggtgaaaatggcagagagcaggaaatttaccagatt
ggtcaattatttgacaaactgattgctggcaattatgaagacgagaactttaaccagtgt
gtcaacattgaagtgattaaacttcagtctgaatttgccctctttcaatttgcctgtgat
actttgaatgagttaaacaatcgtcagttcaaggttctccaacaccaaggagctattctg
gtaactgagaatgacaaacttctcttagtccatttgccccaagcaggggttagcacggca
gatttcttcggtcaagacaagggattggcaagcgtaggagataccatcttgatcgctaca
aaaaatgaaggtaagaccaaggaattccgtaagttttttgagcgttttggctaccaggtt
gagaacctcaacaactatcctgacctgccagatgtagcagaaactggtatgacttttgag
gaaaatgcacggctcaaggctgaaaccatagcagagctgacaggcaagatggtcttggca
gatgattctggtttgaaggttgatgctttaggtggtttgccaggagtttggtctgcccgt
ttttcaggcccagatgccacagatgagctcaataatgccaagctcttgcacgaattggcc
atggtatttgaactgaaagaccgttcggcacaattccattgtactctggtcatggctgct
ccaaatcgtgatagtttggttgtcgaagcggactgggaaggctttatcggtatggacctc
cgtggggaagatgggtttggatatgatccacttttcctcgtaggtgaaacaggtaagacc
tcggcagaattaaccctagaagaaaaaaataagatttcccaccgtgcacaagcactagaa
aaattagtggaggcatttccagtatggcaggagcaagcaaaacaatcctag

DBGET integrated database retrieval system