KEGG   Streptococcus suis ST3: SSUST3_1682Help
Entry
SSUST3_1682       CDS       T01470                                 

Definition
glycoside hydrolase family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sst  Streptococcus suis ST3
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sst00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1671846..1673327)
Genome map
AA seq 493 aa AA seqDB search
MSRFPKNFLWGGAIAANQAEGAYNVDGRGLVQTDVTTGGSVNSPRYTTYIDKDGKPGKYA
SMGHAGGHLPEGATYAVLEDHYYPNHKAVDFYHRYKEDIKLFAEMGYSVFRLSISWARIF
PNGDDAEPNQAGLDFYRSVFEECRKYGIEPLVSIWHFDTPLSLEQRYGGWTNRKLIDFYV
RYAETIFNEYKGLVKYWITFNEINNTIMFLDMFSEPEDSDYQEAYQHLHHQFVASAKAVK
LGHQIDPSYRFGNMICGITFYPGTCDPADILENQHKWEQNIFYCSDAQAKGRYGSYANRL
WKEHNVVLQMEEGDLEILAEGKVDMYTFSYYMSTVVTTHKVEDTVSGNFSIGAKNPYLTY
SDWGWAQDPTGLQYYLEKIYDRYEIPMMIVENGLGALDTVEEDGSIHDDYRIDYHRAHVN
AMADAIANGVDLIGYTTWGCIDLVSAGTGEMRKRYGFIYVDMDDAGNGTLARTPKDSFYW
YKKVIASNGEDVE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgttttccaaaaaatttcctctggggaggagctatcgcagccaaccaggcagaa
ggtgcctataatgtggacggacgcggtctagtccagacagacgttacaacaggaggatct
gttaacagcccccgctatacgacttacattgataaggacggcaagccaggtaaatatgct
tctatggggcatgctggcggtcatctgccagaaggggcgacctatgccgtcctagaagac
cactattatccaaaccacaaggctgtggacttctaccaccgctataaagaagatatcaag
ctcttcgcagaaatgggttactccgttttccgcttgtcaatttcatgggcacggattttc
ccaaacggtgatgatgcagagccaaaccaagcaggtcttgatttctatcgttctgttttt
gaagaatgccgcaaatatggcattgagccattggtttccatttggcacttcgatacacct
ttgagcttggaacaacgctatggtggttggaccaatcgtaagttgattgatttctatgtc
cgctatgctgagacaatttttaatgaatataaggggttggtgaaatattggattaccttc
aatgagattaacaacactatcatgtttttggatatgtttagtgaaccagaggattctgat
taccaagaagcctaccaacacttacatcaccagtttgttgcctctgccaaggctgtaaaa
ttaggtcatcaaattgatccaagttatcgattcggcaacatgatttgtggaatcaccttc
tacccaggaacctgtgaccctgcggatattttagaaaatcaacacaaatgggaacagaat
attttctattgtagtgatgcacaagccaaaggtcgctatggttcctatgcaaacagactg
tggaaggaacacaatgttgtattgcaaatggaagagggagacctagaaatccttgctgaa
ggcaaggtggatatgtataccttctcttattacatgtcaacagttgtgaccactcataaa
gtggaagacacggtttctggaaacttctcaatcggtgccaagaacccttacttgacctat
tcagactggggttgggctcaggatccgaccggtcttcaatactatcttgagaaaatctac
gaccgctatgaaattccgatgatgattgtagaaaatggtttgggagctttggatacagtt
gaagaagacggctctattcacgatgattaccgtatcgactaccatcgcgcccatgtcaat
gctatggcagatgctattgccaatggtgttgatttgattggctatacgacttggggctgt
attgacctagtatcagcaggaacaggtgaaatgcgaaaacgctacggctttatctacgtt
gatatggatgatgctggaaatgggacacttgctagaacaccaaaagattcattctactgg
tacaagaaagtcattgccagcaatggtgaggatgtagaatag

DBGET integrated database retrieval system