KEGG   Streptococcus suis ST3: SSUST3_1888Help
Entry
SSUST3_1888       CDS       T01470                                 

Definition
glucose-1-phosphate-uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sst  Streptococcus suis ST3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sst00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sst00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sst00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sst00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1884605..1885504
Genome map
AA seq 299 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKNDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITDTKAVPLTKQLMNDYEKTHASTIAVMPVPHEEVSAYGVIAPQG
EGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFEILENQKPGAGNEIQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALQHPQVKDDLKQYLIDLGKKLDTKKN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttagaaaagctgttatcccagctgcaggtttgggaacacgtttcttgcct
gctactaaggctcttgccaaggaaatgttgccaatcgttgacaagccaaccatccaattt
atcgttgaagaagccctccgttcaggtattgaagatattttggtggtcactggtaagtca
aaacgttctatcgaagaccactttgattcaaactttgaattggaatacaacctcaaagaa
aaaggcaaaaatgatttgttgaaactggttgatgagacaacaggtattcgactacacttc
attcgtcaaagccatccacgtggacttggggatgctgttcttcaagcaaaagcctttgtc
ggaaatgagccatttgttgtcatgctcggcgatgacttgatggacatcacagatacaaaa
gctgtcccattgaccaagcaactcatgaacgactatgaaaaaacacatgcttcaaccatt
gctgttatgcctgttcctcatgaagaagtttctgcatacggtgttatcgctccacaaggt
gaaggtgtcaacggtctctatagtgtggaaacctttgtggaaaaaccaaaaccagaagac
gctccttctgaccttgctattatcggacgctacttactcactcctgaaatctttgagatt
ttagaaaaccaaaaaccaggtgccgggaacgagattcaattgacagatgccattgatact
ctgaacaaaacgcaacgtgttttcgctcgtgaattcaaaggcaaccgttacgatgttggg
gataagttcggtttcatgaaaacttctatcgactacgccctccaacaccctcaagtaaaa
gatgatttgaaacaatacttaatcgatcttggtaaaaaattagatacaaagaaaaactag

DBGET integrated database retrieval system