KEGG   Streptococcus suis 05ZYH33: SSU05_0060Help
Entry
SSU05_0060        CDS       T00514                                 

Definition
(GenBank) Holliday junction resolvasome, DNA-binding subunit
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSU05_0060
Enzymes [BR:ssu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SSU05_0060
DNA repair and recombination proteins [BR:ssu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SSU05_0060
    RecFOR pathway proteins
     SSU05_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
64526..65116
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGILTKITAKYIVVETQGVGYILQVANPYAYSGQVQQEVTVYTHQVIREDAHLLY
GFATENEKSVFLSLISVSGIGPTTALAIIAVDDNDGLVRAIEQKNITYLTKFPKIGKKTA
QQMILDLEGKFVMSEEAGPVQQVAPSSENIALEEAMEAMEALGYRPAELKKIKKFFEGTN
DTAENYIKSALKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattaaaggaattttaacaaaaataactgcaaaatacattgtggtagaa
acgcaaggagtaggctatatcttgcaggttgctaatccctacgcctattcaggacaagtc
cagcaagaagtgactgtctatactcatcaggtgattcgtgaagatgctcatttgctctac
ggatttgctacagaaaatgaaaaatccgtctttctgagtctgatttcagtatcaggtatt
ggtccaacaacagctctggctattattgctgttgatgataatgatggacttgttcgtgct
atcgagcagaaaaacattacctacctgaccaaatttccaaagattggcaagaaaacagcc
cagcagatgattttggacttggaaggcaagtttgtcatgagcgaagaagcgggtcctgtt
caacaagtagcaccatccagtgaaaatatcgcccttgaagaagccatggaagccatggaa
gcccttggttaccgcccagccgaactcaagaaaatcaagaaattctttgaaggcaccaac
gacaccgcagaaaactacatcaagtcagcccttaaaatgctgatgaagtaa

DBGET integrated database retrieval system