KEGG   Streptococcus suis 05ZYH33: SSU05_0223Help
Entry
SSU05_0223        CDS       T00514                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(210999..211493)
Genome map
AA seq 164 aa AA seqDB search
MSIHKSQGSEFQVVILPITRTSHRMLQRNLVYTAITRSKSKLILLGEISAFDYAVKNAGT
VRKTYLVPRFQGEMAEQESKESLIKKDESKTATTTQTQPPTQPDRKEQVKVVKENNQQLS
LLDQDQPEKTSPQPTEYILTVDNLLTIDPMIGIEQADIEEFFKA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccacaagtcccaaggcagcgagtttcaggtagtcatcctccccatcacccgc
accagccaccgtatgctccagcgcaatctggtctacaccgccatcacccgctccaagagc
aagctcatcctcctgggcgaaatctccgccttcgactacgccgtcaaaaacgccggcacc
gtccgaaaaacctatctggtcccacgtttccaaggggaaatggcagagcaggaaagcaag
gaaagcctgattaaaaaagacgaaagcaaaacagctacaaccacgcaaacccagccccct
actcagccagacagaaaagaacaggttaaagtagtcaaagaaaacaaccaacaactctcc
cttcttgatcaagaccagccagaaaaaacaagtccccaacccacagaatacattttgact
gtagacaacctactaaccatcgaccccatgattggcatagaacaggcagatattgaagaa
ttttttaaagcataa

DBGET integrated database retrieval system