KEGG   Streptococcus suis 05ZYH33: SSU05_0279Help
Entry
SSU05_0279        CDS       T00514                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ssu01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssu00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ssu00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ssu00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ssu00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:ssu00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(265182..266207)
Genome map
AA seq 341 aa AA seqDB search
MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHVANGDFGKVPGRVLGHE
GIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHLEPGQWIAIYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLELAKEVGADVTINGLEVEDVPGYIKEITGGGVHSTVVTAV
SKVAFNQAIDSVRAGGYVVAVGLPSEYMDLSIVKTVLDGIKVVGSLVGTRKDLEEAFHFG
AMGLVVPVVQKRPVEDAEAVFNEMVAGTIQGRMVLDFCHSH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcgttgtaaatccagaatctactggtgttgtcgttgtcgaaaaggaactt
cgtccactcgaagctggtgaggctttggtccaaattgagtactgtggtgtttgtcacact
gacctccacgttgccaatggtgattttggtaaggttcctggtcgcgttcttggtcacgaa
ggaatcggtattgttacagaaatcgcacctggtgttaccagtctaaaagttggtgaccgt
gtcagcgttgcttggttcttccaaggctgtggtatgtgtgaatattgtacaaccggtcgc
gaaactctctgccgtaccgtaaaaaatgcaggctactctgttgacggtggtatggctgag
caatgtattgtaacagcggactatgcagtaaaagttccagaaggtcttgatccagctcaa
gcaagttctatcacttgtgctggcgttacttgctacaaagcgattaaagaagctcacttg
gaaccaggtcaatggattgctatctatggtgctggtggacttggaaaccttgctgtacaa
tacgctaaaaaagtcttcaacgctcatgttatcgccgtagacatcaataatgataaattg
gaactcgccaaagaagttggtgcagatgtgacgatcaacggacttgaagtagaagatgtt
cctggatatattaaagaaattactggtggcggtgtacactctactgttgtaacagctgtt
tccaaagtagccttcaaccaagctattgacagtgttcgtgctggtggatatgtagtagct
gtcggacttccatctgaatacatggacctcagtatcgtgaagactgtgctagacggtatc
aaagtggtcggctcactagttggtactcgtaaagatttagaagaggccttccacttcggt
gctatgggactagttgttccagtcgttcaaaaacgccctgtcgaagatgccgaagcagtc
ttcaatgaaatggttgccggtactatccaaggtcgtatggtcttagacttctgccactca
cactaa

DBGET integrated database retrieval system