KEGG   Streptococcus suis 05ZYH33: SSU05_0422Help
Entry
SSU05_0422        CDS       T00514                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
ssu00230  Purine metabolism
ssu01100  Metabolic pathways
Module
ssu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SSU05_0422
Enzymes [BR:ssu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SSU05_0422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 RsgA_GTPase NB-ARC
Motif
Other DBs
NCBI-ProteinID: ABP89389
UniProt: A4VTF0
Position
402834..403484
Genome map
AA seq 216 aa AA seqDB search
MKDLKGDIMKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQRPGEVDGV
DYFFRSREEFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVK
KKVPDGVFIFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALMREYDYAVVNDEV
PLAAERVKRIIEAEHFRVDRVIGRYDEMIREQIVER
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttaaaaggagatatcatgaaagagcgaggcttactcattgtcttttctggt
ccatctggtgttggaaaaggaacagttcgaaaggaaatttttgaaagctctgataataaa
tttgaatattctgtatccatgacgacacgtccacagagaccgggagaagttgatggagtt
gactatttcttccgtagtcgtgaggaatttgaagatttgattcgccagggtcaaatgttg
gaatatgcagagtacgttggaaattactatggaacacctctgacctatgtcaatgaaact
cttgataagggaattgatgtctttttagaaattgaagtacagggtgccctccaagtgaag
aaaaaggttccagatggggtgttcattttcttgacaccacctgacttggaggagttgcaa
gatcgcttgattggtcgcggaacggatagtgaggaagttattgctcaacgtatcgaacgt
gccaaggaagagattgccttgatgcgtgagtatgattatgcagttgtgaacgatgaagtt
ccgttggctgctgagcgtgtcaagcgtataatcgaagcagaacatttccgtgtagaccga
gtgattggtcgctacgatgaaatgattcgtgaacagatagtagaacgataa

DBGET integrated database retrieval system