KEGG   Streptococcus suis 05ZYH33: SSU05_0449Help
Entry
SSU05_0449        CDS       T00514                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSU05_0449
Enzymes [BR:ssu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SSU05_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
432227..433999
Genome map
AA seq 590 aa AA seqDB search
MKEFYIGDQFYLDGEPFKILSGAIHYFRVHPDDWYHSLYNLKALGFNTVETYVPWNMHEP
RKGEFCYEGILDIERFLKLAQELGLYAIVRPSPYICAEWEWGGLPAWLMKEELRVRSSDS
VYLQHLDEYYVSLIPKLAKLQLAQGGNVLMFQVENEYGSYGEEKAYLRAVAGLMRKHGLT
APLFTSDGSWRATLRAGTLIEDDVFVTGNFGSKARENFANMTAFFNEHQKNWPLMCMEFW
DGWFNRWGDEIIRREPEEMVDSVMECIELGSLNLYMFHGGTNFGFMNGCSARGQIDLPQV
TSYDYDAILDEAGNPTKKFYILQQRLKEVYPELEYAEPLVKEAKAFSDVSLHDKVSLFAT
LENVSDCVKGFYPKNMEELDQSTGYILYRTELERDKTEAERFRVVDARDRIQIYADGKFV
ATQYQTEIGDDVELDFKDDKLTLDILVENMGRVNYGHKLTAPTQSKGIGRGAMADLHFIG
HWETYPLHLESVEDLDFSKGWEEGQAAFYRYQFELDELADTYLDMTGFGKGVVFVNNVNI
GRFWEKGPILYLYIPKGYLKKGANEIVVFETEGKYREKIHFSQRPVIKDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattttatattggagaccaattttatttggacggtgaaccctttaagatttta
tcaggcgcgattcattattttcgtgtccatcctgatgattggtaccattctttgtataac
ttaaaggcccttggttttaatacggttgaaacctatgtcccttggaatatgcatgagcct
cgaaagggtgagttttgttacgagggtatattggatattgagcgatttttgaaattggct
caagaattagggctttatgcaattgtacgaccgtccccctatatttgtgctgagtgggaa
tggggtggcctccctgcttggttgatgaaggaagagcttagagtacgttcgagtgattcg
gtgtacttgcagcacttagatgaatattacgtttctcttattcctaaattggccaagctc
caactcgcacagggtggaaatgtacttatgttccaagtggaaaatgagtatggatcttat
ggtgaggagaaggcatatttaagagcggtggctggcttgatgcgtaaacatggtctaact
gctcccttgtttacctcggacggttcttggcgagcaacattacgtgcaggaacactgata
gaggacgatgtatttgtaacaggaaactttggttctaaagctagagagaattttgcaaat
atgacggcattctttaatgaacatcagaagaattggccactcatgtgtatggaattttgg
gatggttggttcaatcgttggggcgatgaaattattcgtagagagccggaggaaatggtt
gattcagttatggaatgtatcgaattgggctccttgaatctgtacatgttccatggtgga
acaaattttggtttcatgaatggttgctctgctcgtggtcaaattgatttgcctcaggta
acttcttatgattatgatgctatattggatgaagctggaaatcctactaagaagttttat
attttgcaacaacgtttgaaagaagtctatcctgaattagagtatgcagaaccgcttgta
aaagaggcaaaagctttttcagatgtgtcgcttcatgataaggtgagtctgtttgctact
ctagaaaatgtaagcgattgcgtaaaagggttttatcctaagaatatggaagaacttgat
cagtcaacaggttatattttatatagaacagagttggagcgggataagacagaagcagaa
cgtttccgagtggttgatgcgcgtgaccgtatccaaatttatgcagatggaaaattcgtt
gcaactcagtatcagactgagattggtgacgatgttgaattggattttaaagatgacaag
ctaacattagatattttggtagaaaatatgggacgtgtcaattatgggcacaaactaacg
gctcctacccagtctaaagggattggtcgaggtgcgatggctgatttacattttattggt
cattgggaaacctatcctttgcatcttgagtcagttgaggacctggattttagtaagggc
tgggaggaaggtcaagctgctttctatcgttatcagtttgaactggatgaacttgcggat
acttacttagacatgacaggttttggtaagggagttgttttcgttaataatgtaaatatt
ggacgtttttgggaaaaaggaccaatcctctatctctatattccaaaaggatacttaaag
aaaggagcgaatgaaatagttgtcttcgagacagaaggaaaatatagagagaagattcat
ttttcacaaagacccgttataaaagacttgtag

DBGET integrated database retrieval system