KEGG   Streptococcus suis 05ZYH33: SSU05_0630Help
Entry
SSU05_0630        CDS       T00514                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSU05_0630
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SSU05_0630
Enzymes [BR:ssu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SSU05_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
610882..615141
Genome map
AA seq 1419 aa AA seqDB search
MKKETSKFTKKVILGQLLICTSFLVWAGQTVAAEEVSQGEPVAINNETPPVIEAKPLVEA
TPSTETEPSTPEEKQEEPQVAGKNVVEGKKPVTNSQHQMVSELSTVPSVSIKNPDAATDG
SAYGSSDDANSNTKIIAGKETGEPDNGYSKWDHVYVQYDFEKEVPVHTVKIHRNTYDNAV
STFKDVKVELSTSADFSPETTEVIFKQADVEETIANKGQPQVIQLPAPINARYIRIWGRG
HYIQNTNSSWKGYSNGVLFNEIEVLAQVEADAGTNEEPQTELVNLAKLKKPYFYGKAPTN
PEAINDGKFDENYTTQESIGDKAYLQYEFRNVYTIEEIKVQLAPGEYRNFRIDLDDDYND
GNNYNTIYKNENFTIDKEQIITIKTPKNSKARYVRFRGTRVDDTPLRYSEIQIMGRGKSY
DESAPEYVPPKSEYDTLVWSDEFNGDKIDESKWQIIDGMWNHAAIYNRKAVSIKKDGDKS
YLSIRSTNHKDKKTLVEAVGHDRYDDKELPDKVTWSSGRLESKDKYSFQFGRMAVRAKVN
DSKGIWPAIWMLAQDETGHDEIDVLEYLGQNPWYAWTTNHFGILAKNKKSDGSAYKNYEA
WSQEFHVYEVEWTPDVIKWYIDGKFVFQTDRGKDRDGMHTRPMFPILETQVGDGWVGDVD
YKRNMTKQDSEYLVDWVRIYQKADQSKVRFDNLDDAKPNDYVIKPQQKLGHLVTVSNGKA
AHENKNNFYYGGQPRYETSRLYADGDGENALVYKIANPEALHLTTYYKTLEDYSVYNKEA
GANEGKSVRKHLINAKDGEIDFTVYSSVDGKSWNKENVTVVDNFVEATPAYARTTFDIRN
IRKGTKFVKIVFPTVKGISYKLEDGTEKGLQASDVQLAKVTFVATHPEAEPEKPIVDQEK
LALSKVFSLDAGRKYFSVNQIKEIIDLISSYGYTDMNLLLGNDGLRFLLDDMNLTVGDKV
YDSEAVRKAIINGNKHYYDDPNGTTLSQSEMDDILAYAKEKNISIIPTINSPGHMDAIVE
AMEELGIKSPKFSYNGKTSARTVDLKNDQAVAFTKALIDKYASYFAGKSKIFNIGLDEYA
NDATNASGWHILQTQGDYGKFIQYANDLAAIVKKHGLEPMAFNDGIYYNHDTSSGTFDKD
IIASFWTGGWGGYDVASSKFLHEKGHKILNTNDAWYYVIGREAEGLGWYNLDQGLRGTKS
TRFDQVPKSENTKVPIIGSMVAVWADDPSKPYSYDSIKKLLHSFTENNSDYFLAEYRDLR
EEVGKIPTDLNSYTPESVATLKEVLNKIDWKLSRNNQAFVDGYLAEVKAAREALVPVTAK
GDSVKAEPLPEGKLPLITAKGKSVQAEPRPAFKGYLTSNYGPSVTPLSLVSKPSSEQSNS
KQAASQKKELPNTGVVDGLGFSLLGMIGLAFASRRRKKE
NT seq 4260 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaacaagtaagtttacgaaaaaagtcatccttggtcagcttctcatctgt
accagttttttggtatgggcagggcagactgttgcagcagaggaggtatctcagggagaa
ccagtagcaatcaacaatgaaactccacctgttattgaagcaaaaccacttgtagaagct
actccatcaactgaaacagaaccttcaactccagaagaaaaacaggaggaaccacaagta
gctggtaaaaatgtggtagaagggaaaaagccagtaaccaacagccagcatcagatggtt
tctgaattatcaacggtcccttctgtttctataaaaaatccagatgcagctaccgatggg
agtgcttacggtagtagcgacgatgccaatagcaataccaaaatcattgctggtaaagaa
actggcgaaccagataacggttactccaagtgggatcatgtttacgttcagtatgatttt
gaaaaggaagttcccgtccatactgtaaaaattcatcgtaatacttatgacaatgcagtg
tctacttttaaagatgttaaagtggaattgtctacaagtgcagatttttctcctgaaacc
acagaagtcattttcaaacaggcagatgtagaagaaacaattgcaaataaaggacagcct
caagtcatccaattaccagcaccaatcaatgctcgttatattcgtatttggggacggggg
cattatatccaaaatacaaacagttcctggaagggatatagtaatggcgttctctttaac
gagatagaagtcttggcgcaggttgaagcagatgctggtacgaatgaagaaccacaaacc
gagctagtcaacctcgctaaattgaaaaaaccatatttctatggtaaggctccaactaat
ccagaagccattaacgatggaaagttcgacgagaattatactactcaagaatcaataggg
gataaagcttatcttcaatatgaatttagaaatgtctatactattgaggaaatcaaggtt
cagttagctcctggagagtatcgtaatttccggatagatttggatgatgattataatgat
ggtaataattataatacaatctataagaatgaaaatttcaccattgacaaggaacagatt
ataacaattaaaactccgaagaactctaaagcgcgttatgttcgctttagaggtacgcgc
gtagatgatactcctcttcgatattcagaaattcagattatgggacgaggaaaatcttat
gacgaatctgctccagaatatgttccaccaaaatctgaatacgatacattagtctggtct
gatgaatttaatggcgacaagattgatgaaagtaaatggcaaattattgatggcatgtgg
aatcatgcggctatatacaatcgtaaagcagtttctatcaaaaaagatggcgacaagagc
tatttgtctatccgtagcacgaaccataaggataaaaaaactttggttgaagcagttggg
cacgatcggtatgatgataaagaattaccagataaagtaacatggtcttctggtcgccta
gaatctaaagataagtattctttccaatttggtcgaatggctgttcgagctaaggtaaat
gactctaagggaatctggcctgctatttggatgttggcacaggatgagaccgggcatgac
gaaattgacgttttggaataccttggtcaaaatccatggtatgcatggacaactaaccat
tttggtattttggcaaaaaataaaaaatctgatggctcagcttataagaattacgaagct
tggagtcaggaattccatgtctacgaagtcgaatggactccagatgtcatcaaatggtat
attgatggaaaatttgtttttcaaacagaccgtggtaaggatcgggatggtatgcacacc
cgccctatgttcccgatactggaaacccaagttggtgatggctgggttggtgatgttgat
tacaaacgcaacatgactaaacaggatagtgagtacttggttgattgggttcgaatttat
caaaaagcagatcaaagtaaggtacgttttgataatctagatgatgccaagcctaatgat
tatgttattaagccgcagcaaaaacttggtcacctcgtaacagtctctaacgggaaagca
gctcatgaaaacaaaaataatttctactatggaggtcaaccacgttacgaaacaagcagg
ctctatgctgatggtgatggcgaaaatgcactagtctacaagattgctaatccagaggct
ttgcacttaacgacttattacaaaacacttgaagactattctgtctataataaagaagca
ggggctaatgaaggaaaatctgttcgcaaacatttgataaatgcaaaagacggtgaaatt
gacttcactgtgtattcatctgttgacggcaaaagctggaataaagagaatgttactgta
gtggataattttgtagaagcaaccccagcttatgcacgcactacatttgatattcgcaac
attcgaaaaggtactaaatttgtgaagatcgtctttccaacggttaaaggtatttcctat
aagttggaagatggaacagagaaaggcttgcaagccagtgatgtccagttagcaaaagta
acttttgtagctactcatcctgaagcagaaccagaaaaacctattgttgatcaagaaaaa
ctagccttgtccaaagttttttcactcgatgccggtcgcaagtatttctctgtaaatcag
ataaaggagattattgatttaatttcttcttatggttacacggatatgaacctcttattg
ggaaatgatggtctgagatttttattagatgatatgaatttgaccgttggagataaggtg
tatgacagtgaagcagttagaaaagcaataataaatggtaataagcattattatgacgat
ccaaacggtacaaccttaagtcagagtgagatggatgatattcttgcttatgctaaggaa
aaaaatatttccattattccaactatcaatagcccaggtcatatggatgcgattgtagaa
gcaatggaagaattggggataaaatcgccaaaatttagttataatggcaaaacatctgca
cgtacagttgatttaaaaaatgaccaagcagttgcttttactaaagccttaattgataaa
tatgctagttactttgcaggcaaatctaaaattttcaatattggcttagatgagtatgct
aacgatgctacaaatgcttctggatggcacattcttcagacacaaggtgattatggtaag
tttattcaatatgccaatgatttagcagctatcgtcaagaagcatggtttagagccaatg
gctttcaatgatggtatctattataaccacgatactagttcgggtacttttgataaagac
attattgcttctttctggacaggaggttggggaggatatgatgttgcttcctcaaaattc
cttcatgaaaaagggcataaaattcttaatacaaatgatgcttggtactatgttattgga
cgtgaagcagaaggtttgggatggtataaccttgatcaaggtcttcgaggaactaaatct
acaaggtttgatcaagtaccgaaatctgagaatactaaggtacccattattggtagtatg
gttgcggtatgggcagatgacccaagcaagccttacagctatgactcaattaaaaaactt
ttgcacagttttacggaaaacaattctgattattttttggcagagtaccgagatttgcga
gaagaagttgggaagattcctactgatttaaattcctatacaccagagagcgtggcgact
ttaaaagaggtcttgaacaagattgattggaaactaagtagaaataaccaagcgtttgtt
gatggttacttggcagaagtaaaagcagcgcgtgaagcgttagttcctgtgacagcaaag
ggagacagcgtcaaagcggagcccttaccagaaggcaagctacctctgattactgctaaa
ggaaaaagtgtccaagcagaaccacgccctgcctttaagggatacctgacatcaaactat
ggaccatctgtcacacctttatccctcgtatcaaaaccaagcagtgagcagtcaaattcc
aagcaagcagcttctcagaagaaagaattgccaaatacaggagtagtagatggtcttgga
ttctctctccttgggatgattggtctggcatttgctagtcgccggcggaagaaggagtaa

DBGET integrated database retrieval system