KEGG   Streptococcus suis 05ZYH33: SSU05_0645Help
Entry
SSU05_0645        CDS       T00514                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SSU05_0645
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SSU05_0645
Enzymes [BR:ssu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSU05_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
628759..629286
Genome map
AA seq 175 aa AA seqDB search
MKWNIYSLILTRGGYIMSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKEL
QELYDSYKDNGFVVLDFPCNQFLNQAPGSAEDINQICSLNYGTTFPRFAKIAVNGSEASP
LYRYLKKEKSTLLGGRIEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggaacatttattcacttattttgactagaggaggatatataatgagcatttat
gattttacagtacaaaaacaagatggcacagaccagtccatggctgagtatcaaggacaa
gttttacttatagtcaatacagcgccaggttgtggattggcaccacaatacaaggaacta
caggagctatatgatagctataaagacaacggttttgtagtgttggatttcccttgtaat
caatttttaaatcaggctcccggttctgcggaagacatcaatcagatctgtagcttgaat
tatggtacaacttttcctcgttttgctaaaattgctgtgaatggatctgaagctagtccg
ctatatcgctatcttaagaaagaaaaatcaaccttattaggaggtcgaattgagtggaat
tttaccaagtttttggtggatagacaagggcgtgtggtcaaacgatatttaccaacaact
agtccattaaaacttaaagaggatattgaactttacctagaaaaataa

DBGET integrated database retrieval system