KEGG   Streptococcus suis 05ZYH33: SSU05_0832Help
Entry
SSU05_0832        CDS       T00514                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSU05_0832
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU05_0832
   00052 Galactose metabolism
    SSU05_0832
   00500 Starch and sucrose metabolism
    SSU05_0832
   00520 Amino sugar and nucleotide sugar metabolism
    SSU05_0832
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSU05_0832
   00524 Butirosin and neomycin biosynthesis
    SSU05_0832
Enzymes [BR:ssu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SSU05_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
810311..811309
Genome map
AA seq 332 aa AA seqDB search
MCYNKENTFEVMIMSKKIIGIDLGGTSVKLAILTTEGEIQEKWSIKTNILDDGSHIVPDI
IDSIKQRFETHGLTKDDFLGIGMGSPGVVDSEAGTVIGAYNLNWKTLQLVKEQFESALGL
PFFIDNDANVAALGEQWVGAGYNNPYVVFMTLGTGVGGGVIAAGNLIRGVKGAGGELGHI
TVDFDEPFACTCGKKGCLETVASATGIVNLSRRYADQYAGDAKLKQMIDDGQDVTAKDVF
DLAKEGDDLALIVYRHFSEYLGVACANIAAVLNPAYIVLGGGVSAAGEFLLDGVRKVFAE
NSFPQIKESTQIVLATRGNDAGVLGAASLVLK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgtgttataataaagaaaatacatttgaggtgatgattatgtctaaaaaaattatcggt
attgaccttgggggaacttctgttaaattggccattttgactactgagggagaaattcaa
gaaaaatggtctatcaagacaaatattttagatgatggaagtcatattgttcctgatatt
attgacagtatcaagcagcgatttgaaacccatggtttgacaaaggacgatttcttagga
attggtatgggctcacccggtgtagtggatagtgaagctggcactgttatcggagcctat
aacctcaactggaagaccttgcaattggtcaaagagcagtttgaatctgcgctcggttta
ccattctttattgacaatgatgcaaacgtagcggccctcggtgaacaatgggttggtgct
ggatacaacaatccatacgttgtctttatgacgcttggtacaggtgtcggtggcggtgtc
atcgctgctggaaacttgattcgtggtgtcaaaggtgctggtggcgaattgggccatatc
acagttgactttgatgagccatttgcatgtacttgtggtaagaaaggttgtctagaaaca
gttgcttcagcgacaggtattgtcaacctcagccgtcgctatgctgatcaatacgcaggc
gatgcaaaactgaaacaaatgattgatgatgggcaagatgtaacggctaaagatgtcttt
gatttggcaaaagagggcgatgatttggctttgattgtctaccgtcacttctcagaatac
ttaggtgttgcttgtgcaaacattgctgcagtcctcaatcctgcctacatcgttcttggt
ggtggtgtatcagctgcgggagagttcttattggatggcgtacgcaaggtctttgctgaa
aatagcttcccacaaatcaaggaaagtacacaaattgtcttggcaacacgtggtaatgat
gcaggtgtattgggcgcagcatcactcgtcttgaaataa

DBGET integrated database retrieval system