KEGG   Streptococcus suis 05ZYH33: SSU05_1143Help
Entry
SSU05_1143        CDS       T00514                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1091457..1092269)
Genome map
AA seq 270 aa AA seqDB search
MSIEQLANQVTIMGILNVTPDSFSDGGHYNEVESALVQVEKLLAEGATVIDVGGESTRPG
ATFVSEEDEIARVVPIIRAIKENYDCLVSVDTYKTGTARAALEAGADILNDVWAGLYDGD
MLALAAEYKVPIILMHNQKDESYADVVGEVKNFLAERAQAALDAGVSADQIWLDPGFGFS
KNVQHNLDLLQGLEQITALGYPVLFGISRKRVVDYLLGGNSLPTDRDQATAALSAWAVQK
GCKMVRVHNVAANRDIVKVWDQLTSGGQHG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcgaacagttagcgaatcaagtaaccattatggggattctcaatgtgacgcca
gattcattttcagatggtggtcactataatgaggtggagtctgccttggtacaagtagaa
aagttgttggctgagggtgctaccgtcattgatgttggtggtgagtccactcggccaggt
gcaacatttgtgtctgaagaagacgagattgctcgcgtggttccgattatccgcgctatc
aaagaaaactatgactgtcttgtcagcgtcgatacctataaaacaggaactgcacgtgca
gccttggaagcaggcgcagatattttaaatgatgtctgggcaggactttatgatggagat
atgttggccctggctgcggagtacaaggtaccaattattctcatgcacaaccagaaagac
gaaagctatgcggatgttgttggagaggtcaaaaactttctagctgagcgtgcccaagca
gcacttgatgctggtgtttccgcagaccagatttggttggatccaggatttggcttttca
aagaatgtccaacataaccttgatctcttacaaggtttggaacagattactgcccttggt
tatcccgttctatttggaatatctcgtaagcgcgtggtggattatctgcttgggggcaat
agtttaccgactgaccgcgatcaagcaacggcagccttgtctgcctgggcagtccaaaaa
ggctgtaaaatggtccgtgttcacaatgtcgctgccaaccgtgatatcgttaaggtttgg
gaccaattgacttctggaggtcaacatggataa

DBGET integrated database retrieval system