KEGG   Streptococcus suis 05ZYH33: SSU05_1388Help
Entry
SSU05_1388        CDS       T00514                                 

Definition
threonine dehydrogenase and related Zn-dependent dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSU05_1388
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU05_1388
  Lipid metabolism
   00071 Fatty acid degradation
    SSU05_1388
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSU05_1388
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSU05_1388
   00626 Naphthalene degradation
    SSU05_1388
Enzymes [BR:ssu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSU05_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1335291..1336409
Genome map
AA seq 372 aa AA seqDB search
MNSKVYNIPYQSERTFINKCRCVENMKAAIYEKAGKMTVAEIEKPSLQAKDDVIIKVVRA
CVCGSDLWGYGEDIHHDHGDTNSGHEAIGIVEEVGEDITTLVPGDFVIVPFTHGCGHCDA
CRAGFDGTCDNHPGYTNWGNNYQSQYIRFHYGNWALVKIPGQPSDYSEGMIKSLLTLADV
MPTGYHATRVADVKPGDKVVVIGDGAVGQCAVIAAKMRGASQIIMMSRHADRQQMALESG
ATAVVAERGEEGIAKVREILGGGADAALECVGTEASIDQALGVLHNGGRIGFVGVPHYNN
HALGSTFAQNIIIGGGSASVTTYDKEILLDAVLKGDINPGRVFTQTYSLDNIDQAYKDMA
NRKTIKAMITVD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgaactccaaggtgtataatattccatatcaatcagaaaggacatttattaataaatgt
aggtgtgtagaaaatatgaaagcagctatttatgaaaaagccggtaagatgaccgttgca
gaaatcgaaaaaccaagccttcaagccaaagatgacgtcattatcaaggtcgttcgggcc
tgtgtctgtgggtcggacctttggggctacggagaagacattcaccatgaccacggtgac
acaaactctggtcatgaagccatcggtatcgttgaagaggtaggcgaagacattacaaca
cttgttcctggtgacttcgttatcgttccatttacacatggttgcggacactgtgatgcc
tgtcgtgctggctttgacggtacttgtgacaaccatccaggctacaccaactggggcaac
aactaccagtctcaatatattcgtttccactacggtaactgggccttggtcaaaattcct
ggtcagccaagcgactactcagaaggcatgatcaaatctctcttgactctggcagatgtt
atgccaacaggctaccatgctacgcgtgttgcagatgtcaaacctggtgataaggtggtt
gtcatcggtgatggtgcagtggggcaatgtgccgtcattgctgcaaaaatgcggggagct
tcgcagattatcatgatgagccgtcatgctgaccgtcagcaaatggctctggaatcaggg
gctactgctgttgttgctgaacggggcgaggaaggaattgccaaagtccgtgaaattctt
ggaggtggcgctgatgctgccctcgaatgtgtcggaacagaagcttctattgaccaagcc
ctcggcgtccttcataatggcggtcgcatcggttttgttggtgtgcctcattacaacaac
cacgccctcggatcaacttttgctcaaaatatcattatcggtggtggctctgcttctgtc
acaacctatgataaggaaattttgcttgatgctgttctcaaaggcgacatcaacccaggt
cgagttttcacccaaacttacagcctggacaatatcgaccaagcctacaaagacatggcc
aaccggaaaacgattaaagctatgattacggtggattaa

DBGET integrated database retrieval system