KEGG   Streptococcus suis 05ZYH33: SSU05_1396Help
Entry
SSU05_1396        CDS       T00514                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SSU05_1396
Enzymes [BR:ssu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SSU05_1396
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SSU05_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1341984..1342877)
Genome map
AA seq 297 aa AA seqDB search
MCKSHSVALLIFSRFLRSWYRKLPELPEVETVRRGLNRLVKGKVISKVEVTYAPMIKTGV
DAFCQDLIGQEILDVDRRGKYLLIYLTDHVLISHLRMEGKYNFFADQVPANKHFHAFFTF
IDGSTLVYQDVRKFGTMELLGKADVDAYFISRKIGPEPTEEDFDLEEFAKKLAKSKKPIK
SHLLDQSLVAGLGNIYVDEVLFKAKVHPAQTSNQLSTDQVADLRQATIEVLQLGIEKGGS
TIRTYKNALGMDGTMQDYLQVYGKTGQACPRCQTEIVKIQLGGRGTHFCPKCQVKHG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcaagtcacacagcgtcgctctcctaattttcagtcgctttttacgctcttggtat
cgtaaattgcccgaattgcctgaggttgagacggttcgtcgtggtttgaatcgtttggtc
aagggaaaagttatttccaaggtggaggtgacctatgctcccatgattaagacaggtgtg
gatgccttctgccaagacttgattggtcaggagattttagatgtggaccgtcgtggcaag
tatctcttgatttacctgacagaccatgtcctcatttctcatttgcggatggaaggtaag
tacaatttctttgctgaccaggtgcctgccaacaaacatttccatgccttttttactttt
atagatggctcgaccttggtctatcaagatgtccgcaagtttgggaccatggaactgctg
ggtaaggcagatgtggatgcctattttatcagtcgaaaaattggtcctgagccgacggag
gaagattttgacttagaagaatttgccaaaaagttagctaagtcgaaaaagcccattaag
tcgcatcttttggaccagtctttggtggctggtttgggcaatatttatgtcgatgaggtc
ttgttcaaggccaaagttcatcctgcacaaacgagtaatcagctgtcgacagatcaggtg
gcagacctccgtcaagccaccattgaagtcctgcaactgggtattgaaaaaggtggttca
accattcggacttacaaaaatgccttgggcatggatgggactatgcaggattatttacaa
gtttacggaaagacagggcaggcctgtccccgttgccagacagagattgtcaaaatccag
ctgggcggacgggggacacatttctgtcccaagtgtcaggtgaaacatggctaa

DBGET integrated database retrieval system