KEGG   Streptococcus suis 05ZYH33: SSU05_1638Help
Entry
SSU05_1638        CDS       T00514                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSU05_1638
   01230 Biosynthesis of amino acids
    SSU05_1638
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU05_1638
  Energy metabolism
   00680 Methane metabolism
    SSU05_1638
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSU05_1638
Enzymes [BR:ssu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSU05_1638
Exosome [BR:ssu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSU05_1638
  Exosomal proteins of melanoma cells
   SSU05_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1553389..1553958)
Genome map
AA seq 189 aa AA seqDB search
MIKEAGIEFDLAFTSVLKRAIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGLNKAEA
AAEFGDEQVHIWRRSYDTLPPEMAKDHEHSAHTDRRYAHLDDSVIPDAENLKVTLERALP
FWEDKIAPALKDGKNVFVGAHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFELDENLN
IVKEYYLEA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaaagaagcaggtatcgaatttgaccttgctttcacatctgtattgaaacgtgct
atcaagactacaaacttggctcttgaagctgcagatcaattgtgggtaccagttgaaaaa
tcgtggcgtttgaacgaacgtcactacggtggtttgactggcttgaacaaagctgaagca
gctgctgaatttggtgatgagcaagttcacatctggcgtcgttcttatgatactttgcca
ccagaaatggctaaagatcatgagcattcagcacacactgaccgtcgctatgcacacctt
gatgattcagttattccagatgcagaaaacttgaaagtaacgcttgagcgtgcccttcca
ttctgggaagataaaattgctccagcattgaaagacggtaaaaacgtattcgtgggtgca
cacggtaactcaatccgtgcccttgtaaaacacatcaaacaattgtctgatgacgaaatc
atggatgtggaaattccaaacttcccaccacttgtattcgaattggatgaaaacttgaac
attgtgaaagagtactacttggaagcataa

DBGET integrated database retrieval system