KEGG   Streptococcus suis 05ZYH33: SSU05_2027Help
Entry
SSU05_2027        CDS       T00514                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ssu00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1929318..1930712)
Genome map
AA seq 464 aa AA seqDB search
MPVQHCLTYLFARHHGGTFLIRIEDTDRKRHVEDGERSQLENLRWLGIDWDESPETHENY
RQSERLDIYQKYVDQLLAEGKAYKSYVTEEELAAERERQEAAGETPRYINEYLGMSEDEK
TAYIAEREAAGIVPTVRLAVNEAGIYKWNDIVKGEIEFEGGNIGGDWVIQKRDGYPTYNF
AVVIDDYLIKISHVIRGDDHIANTPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRD
TNTLQFIEDYRRKGYMPEAVFNFIGLLGWNPGGEEEIFSREQFIQLFDENRLSKSPAAFD
QKKMDWMSNEYIKNADLETIFNLAKPFLEEAGRLTDKAEKLVELYKPQMSSADEIVGLTD
LFFSDFPELTAEEKEVMAGETVPTVLNALKEKLEAMTDEDFQPDNIFPQIKAVQKETGIK
GKNLFMPIRIAVSGEMHGPELPNTIYLLGREKSIQHIDNMLKSL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtacagcattgtttaacctatctttttgcccgtcatcatggcggtactttcctc
attcgtatcgaggatacagaccgcaagcgccatgtggaagacggcgagcgttctcaactt
gaaaacctgcgttggttgggtattgactgggatgagagtccagaaacccatgagaactac
cgtcagtctgagcgtttggatatttaccaaaagtatgttgatcagctcttggcagaaggc
aaggcctacaagtcttatgtgaccgaagaagagttggcggcggagcgtgagcgtcaggaa
gctgcgggcgaaacacctcgctacatcaacgaataccttggtatgtctgaggatgaaaaa
actgcctacatcgcagagcgtgaggcggctggcattgtcccaacggtccgcttggctgtc
aacgaagctggtatctacaagtggaacgacatagttaagggtgagatcgagtttgaaggt
ggcaacatcggtggtgactgggttatccagaaacgtgacggctacccaacctacaacttt
gccgtggtcattgatgattatctcattaaaatctcgcacgttatccgtggggatgaccac
attgccaacacacccaagcagctcatggtctatgaagcacttggttgggaagcgccagaa
tttggtcacatgacgcttattatcaattctgaaacaggtaaaaagttgtctaaacgtgat
actaacacccttcagttcatcgaagattaccgccgtaaaggttacatgcctgaggctgtc
ttcaactttatcggtcttttgggttggaacccgggtggtgaagaggaaatcttctctcgt
gagcaatttatccaactcttcgatgagaaccgtctcagcaagtcacccgctgcctttgac
cagaagaaaatggactggatgagcaatgagtacatcaaaaatgctgatttagaaactatt
ttcaaccttgctaagccattcttggaagaagcggggcgtttgacagacaaggcagaaaaa
ttggtggaactttacaagccacagatgtcatctgcggatgaaatcgttggtttgacagac
cttttcttctctgatttcccagaattgactgcggaagaaaaagaagtcatggcaggcgaa
acggttccaactgttctcaacgccctcaaggaaaaattggaagccatgacggacgaagat
ttccaaccagataacatcttcccacaaatcaaggctgttcaaaaagaaacaggcatcaag
ggcaaaaacctcttcatgccaatccgtatcgctgtttcaggcgaaatgcatggacctgag
ttgccaaatactatttacctgctcggccgtgaaaaatccatccagcatattgacaatatg
ttgaagagtttgtaa

DBGET integrated database retrieval system