KEGG   Streptococcus suis 05ZYH33: SSU05_2041Help
Entry
SSU05_2041        CDS       T00514                                 

Definition
glucose-1-phosphate-uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSU05_2041
   00052 Galactose metabolism
    SSU05_2041
   00500 Starch and sucrose metabolism
    SSU05_2041
   00520 Amino sugar and nucleotide sugar metabolism
    SSU05_2041
Enzymes [BR:ssu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSU05_2041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1942763..1943662
Genome map
AA seq 299 aa AA seqDB search
MKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALRSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKNDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITDTKAVPLTKQLMNDYEKTHASTIAVMPVPHEEVSAYGVIAPQG
EGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFEILENQKPGAGNEIQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALQHPQVKDDLKQYLIDLGKKLDTKKN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttagaaaagccgttatccctgcagcaggtttgggaacacgtttcttgcct
gccactaaggctcttgccaaagaaatgttgccgattgttgataaaccaactattcaattt
atcgttgaagaagctctacgatctggtatcgaagatattttggtggtcactggtaaatca
aaacgttctatcgaagaccactttgattcaaactttgaattggaatacaacctcaaagaa
aaaggcaaaaatgatttgttgaaacttgttgatgagacaacaggcattcgactacacttc
attcgtcaaagccatccacgtggacttggtgatgccgttcttcaagctaaagcatttgtc
gggaacgagccatttgttgtcatgctgggcgatgacctcatggacatcacagatacaaaa
gctgtcccattgactaagcaactcatgaacgactatgaaaaaacacatgcttcaaccatt
gctgttatgcccgttcctcatgaagaagtttctgcatacggtgttatcgctccacaaggt
gaaggtgtcaacggtctctatagtgtggaaacctttgtggaaaaaccaaaaccagaagac
gctccttctgaccttgctattatcggacgctacttactcactcctgaaatctttgagatt
ttagaaaaccaaaaaccaggtgccgggaacgagattcaattgacagatgctatcgataca
ctcaataaaacacaacgcgtgtttgctcgtgaattcaaaggcaaccgttacgatgttggg
gataagttcggtttcatgaaaacttctatcgactacgccctccaacaccctcaagtaaaa
gatgatttgaaacaatacttgatcgatcttggtaaaaaattagatacaaagaaaaactag

DBGET integrated database retrieval system