KEGG   Streptococcus suis 05ZYH33: SSU05_2078Help
Entry
SSU05_2078        CDS       T00514                                 

Definition
beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1979640..1981040)
Genome map
AA seq 466 aa AA seqDB search
MTKDKVFYQFPTNFLWGSSTSGPQSEGIEPGDGKGQNNWDYWYSIEPERFHNKIGPSQTS
TFYKHYEKDIDLLVETGHTVFRTSIQWSRLIPTGTGEINQEAVSFYRSVFSLVRAKGIQL
FVNLYHFDLPYCLQEKGGWENKEIVRAYEAYARTCFELFDDLVDRWITFNEPIVPVECGY
LGNYHYPCKVDAKAAVAVAYHTQLASSLAVKACHEVNPHKKIAIVLNLTPAYPRSEQAED
IKAARIAELFQTKSFLDPSVLGEYPDDLVELIDAYGLMPEVSDEELAIIKENRVDFLGVN
YYQPLRVQAPTNSWKEGEPLTPEYFFAPYDMPGKKMNPHRGWEIYEKGIYDIAINIKENY
HNIEWFVTENGMGVEGERAFKDNGLIQDDYRIEFIEDHLIELHRAIQEGANCKGYMLWTF
IDCWSWLNAYKNRYGLVELDLDTQERIVKKSGKWFKKLSDANGFHR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagacaaggtattttatcaatttccaacaaattttttgtggggttcttctaca
tcaggacctcaaagtgaaggaatcgagccaggtgatggaaaaggacagaacaactgggat
tattggtatagtattgagcctgaacgatttcataacaaaattggccctagtcaaacatca
acattttacaaacattatgaaaaagatattgatttactagttgaaactggacacactgta
tttcggacttccattcaatggtcgcgtctcataccaacaggtactggagaaattaatcaa
gaggcggtgtccttctatcgttcggttttttctttggtaagagcaaagggaattcagctc
tttgtcaatctttatcactttgatcttccctattgtttacaagaaaaaggtggttgggaa
aataaggaaattgttcgagcctatgaagcatatgcacgtacatgttttgaattgtttgat
gatttagtcgatcgttggattacctttaatgagccgattgttccagtagagtgtggttat
ctaggaaattatcattatccatgtaaggttgatgcaaaagcggcagttgcggtggcttat
catacacagttggcaagttctttagctgtaaaggcatgccatgaggtaaatcctcacaaa
aaaatcgctattgtcttgaatctaactcctgcctaccctcgtagtgagcaagcagaggat
ataaaagcagctcgaattgcagaattgtttcaaacaaagagctttctagatccgtctgtg
ttaggagaatatcccgatgacttagtcgagctgattgatgcatatggtctaatgccagag
gtcagcgatgaggaattagccattattaaggaaaatcgtgtggacttcctaggggtgaat
tattatcaaccccttcgggtacaagctccaaccaatagttggaaagagggagagcctcta
actccggaatatttctttgccccatatgatatgccaggtaaaaaaatgaatccgcataga
ggttgggagatttatgaaaaagggatatacgatattgcgataaatattaaggaaaattac
cataatatcgaatggtttgtaacagaaaatggtatgggagttgaaggagagcgcgcattt
aaagacaatggactcattcaagatgattaccggatcgaatttatcgaagatcacttaatt
gaattacatcgagctatccaagaaggggcgaattgtaaaggatacatgttatggaccttt
attgattgctggtcttggttaaatgcatacaagaatcgctatggattagttgaactggat
ctagacacgcaagaaagaattgttaagaaatcaggcaagtggttcaagaaattgagcgat
gctaatggttttcatcgctag

DBGET integrated database retrieval system