KEGG   Streptococcus suis 05ZYH33: SSU05_2131Help
Entry
SSU05_2131        CDS       T00514                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSU05_2131
Enzymes [BR:ssu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SSU05_2131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2034690..2035481)
Genome map
AA seq 263 aa AA seqDB search
MWLQDAHQMPFRKIGQLWGNPIYDWEAMKHDGGTCWVARLRESFKIYDMVRIDHFIGFAS
FWEIPAGEETAVNGYRVEAPGFELFDTIKRELGDLNIIAEDLGSVTDKVIQLRDTTGFPG
MKVLQFAFDPEGDSIEMPHNHPNNVVAYTGTHDNDTILGWYENETTKESRAFLDKYSNRR
EGETVSHALFRLLFGSPAFMAVATMQDLLGLDGSARMNLPNTLGGNWTWRMTADQLTPEI
EAELLDLTETYRRVNVHLVDEKS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgtggttgcaggatgcccaccagatgccttttcggaaaattggtcagctttggggcaat
ccgatttatgattgggaagcgatgaagcatgacggaggtacttgttgggttgctcgttta
cgtgaatcctttaagatatacgatatggtacgtatcgaccactttatcggctttgcctcc
ttctgggaaattccagcgggtgaagaaacagctgtaaatggctatcgtgtcgaagcacca
ggttttgagttatttgatacaatcaaacgtgaactcggagacttaaatatcatagctgag
gatttgggctctgtgacagacaaggtcatccaattacgtgatacgacaggttttcctggt
atgaaagtcctgcagtttgcttttgatccagaaggagacagcattgaaatgccacataac
catcctaataatgtggtggcatatacgggaacccatgacaatgatacgattcttggctgg
tacgaaaatgaaacaacgaaagaatcgcgtgcattcttagataagtacagcaatcgtcgt
gagggggaaacggtcagtcatgctcttttccgtctgctctttggttcacctgcctttatg
gcggtggctactatgcaggacctacttggtttggatggttcagctcgcatgaacttgcca
aatacgcttggtggtaactggacttggagaatgacggcagatcaattgacaccagagatt
gaagcggaattgctagaccttacagaaacttatcgtcgggttaatgtgcatttggttgat
gaaaagtcataa

DBGET integrated database retrieval system