KEGG   Streptococcus suis 05ZYH33: SSU05_2132Help
Entry
SSU05_2132        CDS       T00514                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ssu  Streptococcus suis 05ZYH33
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2035411..2036208)
Genome map
AA seq 265 aa AA seqDB search
MKVRQSGVLMHISSLPGKYGIGSMGQSAYEFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDFDILIDKGWLAAEDLHGVDFGQNPTEVDYAAIFYARRPLLEKVVANMK
AQGLPEDYWMFLGENDFWIHTFAEYMAIKEHFDLKPWTEWEDQGARLRYHDTLEYYRHLL
ADRIDYHRITQYLFFSQWKALKAYANAKGVEFVGDMPIYIAADSADMWANPHFFKTDEEG
KPSVVAGCPPDAFSENWSALGQSDL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagacagagtggtgtgctgatgcacatttcatcattacctgggaaatatgga
attggttccatgggccaatcggcttatgaatttgttgattttttggtaagaactaagcaa
cgctattggcaaatcttacctttgggaacaaccagttatggagattctccttaccagtca
ttttcagcttttgcagggaatactcattttattgattttgatatattgattgataaaggc
tggctggcagcagaggatttacacggtgttgactttgggcagaatcctacagaggtagat
tacgcagccattttttatgctcgacgtccattactggagaaggtagttgccaacatgaag
gcacaaggcttgccagaagattattggatgttcttaggggagaatgacttttggattcat
acctttgcggagtatatggctataaaagagcattttgatctcaaaccttggacagagtgg
gaagatcaaggggcgcgcttacgttaccacgataccttggaatattatcgtcacttgttg
gcagatcgaattgattatcaccgcattacacaatatttattcttttcacaatggaaggct
ttaaaggcttatgccaatgccaaaggtgttgagtttgtcggggatatgccgatttatatc
gcggctgattctgccgatatgtgggctaatccacatttctttaaaacggatgaagaaggc
aagccgagtgtggttgcaggatgcccaccagatgccttttcggaaaattggtcagctttg
gggcaatccgatttatga

DBGET integrated database retrieval system