KEGG   Streptococcus suis T15: T15_2058Help
Entry
T15_2058          CDS       T02891                                 

Gene name
pbp2A
Definition
penicillin-binding protein 2A
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
ssui  Streptococcus suis T15
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ssui00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    T15_2058 (pbp2A)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    T15_2058 (pbp2A)
Enzymes [BR:ssui01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     T15_2058 (pbp2A)
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     T15_2058 (pbp2A)
Glycosyltransferases [BR:ssui01003]
 Polysaccharide
  Bacterial polysaccharide
   T15_2058 (pbp2A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2052492..2054705)
Genome map
AA seq 737 aa AA seqDB search
MDDLQHQPIEVPEDFQINHEDRPSRRRRGNSGSVDKPKKKSRIPEPIRKFWRRYQLTKIL
IILMVLTVLTVGGYLFFLAKTANVGDLQQALKATTIIYDKDGAEAGTLSGQKGTYVELDA
ISDNLENAVIATEDRSFYKNSGINYQRTILAALTLGRSGGGSTITQQLAKNAFLTQDQTI
SRKAREFFLALEINKKYSKQEILTMYLNNAYFGNGVWGVEDASQKYFGIPASNLTLEQAA
VIAGMLKGPEIYNPYYSLENAVNRRDTVLQNMVNAGYIDQATADAGFQVDLASQLSDTYT
GKQSNYSYPSYFDAVIAEAIERYGLKESDIINNGYRIYTEMDQNSQANMQVIFNDETMFP
TSSFDGTHAQAASVALDPRTGGVRALVGRVNSSEDAVFRTFNFATQAKRSPGSTIKPLVA
YAPAVAAGWSIDMALDNHTETYGDYTLHNYDYSTSDTIPMYQALALSYNLPVAYIVNTLG
IDKAFEYGQKFGLDMENVEKVLGVSIGSGVETNPLQMAQAYATFANKGVMKDAHLITRIE
TASGKVLAEHRETSTKVIDRSVADKMTAMMLGTYTNGTGVTADTANYHIAGKTGTTETSF
DVNLVNDQWHIAYTPDLVISQWVGFEQTDENHYIDSSSYWKAPSVFQTVANSILPYTAGT
QFEVENAYAQNGIVEVAPDEATQTESSLGQEQVQEISDQAKNLIEQTKQNLIDAKLPERA
KTLWDNITSWFGELSNP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggacgatttgcaacatcaaccgattgaagttccagaagatttccaaattaatcatgaa
gaccgacctagccgtcgccgcaggggaaatagtggctctgttgataaaccaaagaaaaaa
tcacgtattccggagccgattcgtaaattttggcgccgttatcaactgactaaaatttta
atcattttaatggtcctgacagttcttacagtaggtggctatctatttttccttgcaaag
acagctaatgttggtgatttacagcaggcgctaaaagccacaacgattatttacgataaa
gatggtgcggaagctgggacattgtctggtcagaaggggacctatgtagagctggatgct
atctctgataatttagagaatgccgttatcgctacagaagatcggagcttctacaaaaat
tcaggcattaattaccagcgtacaattttggccgccttgacgttaggtcggtctggaggt
ggttcaactattacccagcaattggcaaaaaatgcctttctaactcaggatcagaccatc
agtcgaaaggctcgagaattctttttggctctggaaatcaataaaaagtacagcaagcaa
gaaattttgaccatgtatctcaacaatgcctactttggaaacggggtctggggagtggaa
gatgcaagccaaaagtacttcggtattccagctagtaatcttactcttgagcaagcggcc
gtcatagcaggtatgctcaagggacctgagatttataatccttattattctctagaaaat
gcagttaatcgtcgggatacagtcctgcaaaatatggtcaatgctggttatattgatcag
gcgactgcagatgcaggtttccaagtagacctagccagtcagctttcagatacctataca
gggaaacaaagcaattattcctatccatcctattttgatgctgtgattgctgaggcgatt
gagcgatacggactgaaagaatcagacattattaataacggctataggatttacacagag
atggatcaaaattctcaagccaacatgcaggtgatttttaatgatgagactatgttccca
acatcaagttttgatggtacccatgctcaggctgccagcgtagctcttgatcctaggact
ggtggagttcgcgccttggttggtcgagttaacagttcagaggatgcggtctttcggacc
ttcaactttgcgacacaagccaagcgcagtcctggttcaacaatcaagcctcttgttgcc
tatgctccagcagtagcggcgggctggtcgattgatatggctctggataaccatacagaa
acctacggcgattacaccttgcataactatgattattcgacttctgataccattccaatg
tatcaagctttggctctctcttacaatttaccagtagcttatatagtgaacaccttgggt
attgacaaagccttcgagtatggacaaaagtttggacttgatatggaaaatgtcgagaaa
gttttgggtgtttcaattggttctggagtggagaccaatcctctgcaaatggcccaggcc
tacgctacttttgcgaataagggtgtgatgaaggatgcccacctcatcactcgtattgaa
acggctagtggaaaggttttagcagagcatcgagaaacaagtaccaaggtgattgaccgt
tctgtcgcagataagatgacagcaatgatgcttggtacctataccaatggtacgggagtg
acagcagatacggccaattatcatatcgctgggaaaacaggaacaaccgaaacgagtttt
gatgtcaatctcgtcaatgatcagtggcatattgcctacacacctgatttggtcatcagt
cagtgggttggttttgagcagacagatgaaaatcattatatagatagcagtagctactgg
aaggctccgtcggtcttccagactgtggccaattcaatcttgccatatactgcaggaact
cagttcgaagtagaaaatgcctatgcacaaaatggtattgtagaagtagctccagatgaa
gctacgcaaactgaatcaagccttggtcaagaacaggtacaagaaatttcagatcaggcg
aaaaacttgattgagcaaaccaaacaaaatctaatcgatgccaagttaccagaacgagca
aaaaccttgtgggataacattacgtcttggtttggagagttgtcaaatccataa

DBGET integrated database retrieval system