KEGG   Streptococcus suis SC070731: NJAUSS_0269Help
Entry
NJAUSS_0269       CDS       T02536                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ssus  Streptococcus suis SC070731
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssus00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NJAUSS_0269
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NJAUSS_0269
   00620 Pyruvate metabolism
    NJAUSS_0269
   00650 Butanoate metabolism
    NJAUSS_0269
  Lipid metabolism
   00071 Fatty acid degradation
    NJAUSS_0269
  Amino acid metabolism
   00350 Tyrosine metabolism
    NJAUSS_0269
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NJAUSS_0269
   00626 Naphthalene degradation
    NJAUSS_0269
Enzymes [BR:ssus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NJAUSS_0269
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     NJAUSS_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269978..272629
Genome map
AA seq 883 aa AA seqDB search
MADKKVVSPEEKLVETRKHVDELVQKGLVALDEFRKLGQEEVDYIVAKASVAALDKHGEL
AMHAFEETKRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDEVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLIALKTRNPIVFAFHPSAQESSAHAARVVYEAAVAAGAPENCIQW
ITKPSMEATSELMKHDGIATILATGGNAMVRAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVAEFKSYKTYFVNKKEKALLEEYCFGV
KANSKNCAEGKLNADIVGRPAAWIAEQAGFSVPEGTNILAAEVAEIGEKEPLTREKLSPV
IAVLKVDGRAEGLEAARQMVEFHGLGHSAAIHTEDAELAKGFGTIVRAIRVIWNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSISDNVSAMNLLNIKKVGRRRNNMQWFKVPSKTYFER
DSIQYLQKCRDVERVMIVTDRAMVELGFLDRIIEQLDLRRNKVVYQIFSDVEPDPDITTV
YKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPTVDFHDLVQKFMDIRKRAFKFPE
LGKKSKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPAH
VTADTGMDVLTHATEAYVSTVANDFTDGLALQAIKLVFENLESSVKNADFVSREKMHNAS
TMAGMAFANAFLGISHSMAHKIGGRFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YKADEKYQDIARLLGLPCSTPEEAVAAYAQAVYDLGERIGIQMNLKAQGIDEKELKEHSR
ELALLAYEDQCTPANPRLAMVDHMQEIIEDAYYGYKERPGRIK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaagtagtatcaccagaagaaaagttggtagaaacgcgcaagcacgtc
gatgagcttgttcaaaaaggtttggttgctcttgatgagttccgtaaacttggtcaagaa
gaagtagactatattgtagcgaaagcttcggttgcggcccttgataaacacggtgaattg
gcaatgcacgcctttgaagaaaccaaacgtggtgtattcgaagacaaggctactaagaac
ttgtttgcctgtgagcacgttgtcaataacatgcgccacacgaaaactgttggtgttatc
gaagaagatgaagtgacaggtttgactttgattgctgagccggtcggtgttgtttgtggt
atcacaccaacaacaaacccaacttctacagcaatctttaaatcattgattgccttgaag
acacgtaatccaattgtctttgccttccacccatctgcacaagaatcttctgctcatgca
gctcgtgttgtctatgaagcagctgtggcagctggtgcccctgaaaactgtatccagtgg
attacaaaaccatctatggaagcaacatctgagttgatgaaacatgatggtattgcaaca
atccttgcaactggtggtaacgcaatggtgcgtgcagcttactcttgtggtaaacctgcc
cttggtgtaggtgcaggtaacgttccagcctatgttgaaaaatcagcaaacatccgtcag
gcagcacatgacatcgttatgtctaagtcatttgacaacggtatggtctgtgcgtcagaa
caagcagttatcattgataaagaagtttacgatgagtttgtagcagagttcaaatcttac
aaaacttacttcgttaataagaaagaaaaagctcttcttgaagaatactgcttcggtgtg
aaagctaacagcaaaaactgtgctgaaggtaaattgaacgcagacattgttggtcgccca
gctgcatggatcgctgagcaggccggcttctcagtaccagaaggtacaaacatcttggca
gctgaggttgctgaaatcggtgagaaagaaccattgactcgtgagaaattgtcacctgtt
attgccgtcttgaaagttgatggtcgtgcagaaggtcttgaagcagctcgccaaatggtt
gaattccacggtctcggtcactctgcagctattcatacggaagacgcagaattggcgaaa
gggtttggtacaatcgtacgtgctatccgtgttatttggaactctccatctactttcggt
ggtatcggtgatgtttacaacgcattcttgccatcattgacacttggttgtggttcttac
ggacgcaactcaatcagtgataacgtaagtgctatgaacttgctcaacatcaagaaagta
ggaagacgtagaaataatatgcaatggtttaaagttccttctaaaacatacttcgaacgt
gactctatccaatatctccaaaaatgccgtgacgttgaacgtgtcatgatcgttacagac
cgtgccatggtagaacttggattcctagatcgtatcatcgaacaattggaccttcgtcgt
aataaagttgtttaccaaatcttctcagacgttgagccagatccagacatcacaacggtt
tataaaggtacagaattgatgcgtaccttcaaaccagatacaatcatcgcactcggtggt
ggttcaccaatggatgctgccaaagttatgtggctcttctacgaacaaccaacagttgat
ttccatgacctagttcaaaaattcatggatatccgtaaacgtgccttcaagttcccagaa
cttggtaagaaatctaagtttatcgcgattccaactacatcaggtacaggttcagaagta
acaccgttcgccgtaatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaatcgttgacccagcactcgtattgacagtacctgcacac
gttacagcagatactggtatggacgtattgactcacgctacagaagcatacgtttcaaca
gtagcaaacgactttacagatggtttagcacttcaagctatcaaactagtatttgaaaac
cttgaaagctcagtgaagaatgctgactttgtatcacgtgagaaaatgcacaacgcatca
actatggcaggtatggccttcgccaacgcattcctaggtatttctcactcaatggctcat
aagattggtggacgtttccataccgttcacggtcgtacaaacgctatcttgcttccatac
gttatccgctacaacggtactcgtcctgccaagacagctacatggcctaagtacaactac
tataaagcagatgaaaaataccaagacatcgcacgtcttctaggcttgccatgctcaaca
ccagaagaagctgttgcagcatacgcacaagcagtttacgacctcggtgaacgcatcggt
atccaaatgaatttgaaagcacaaggtatcgacgagaaagaactcaaagaacactctcgc
gaattggctcttcttgcctacgaagatcaatgtaccccagctaacccacgtctagcaatg
gttgaccacatgcaagaaatcatcgaggatgcctactacggttacaaagaacgtccaggt
cgcatcaagtaa

DBGET integrated database retrieval system