KEGG   Streptococcus suis SC070731: NJAUSS_0523Help
Entry
NJAUSS_0523       CDS       T02536                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ssus  Streptococcus suis SC070731
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ssus00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NJAUSS_0523
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NJAUSS_0523
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NJAUSS_0523
Enzymes [BR:ssus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NJAUSS_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
548811..549887
Genome map
AA seq 358 aa AA seqDB search
MTEKTIVFKVGTSSLTQENGSLDRIKIARITNQLAQLHQKGYQIVLVTSGSIAAGFRRLG
FDKRPTKIAEKQASAAVGQGLLIEEYTQNLMKDGIVSAQILLTQDDFADARRYQNASQAL
QVLLKQRAIPIINENDTIAIEEIKVGDNDTLSAQVASLLKADLLVLLTDVDGLYTANPNS
DPTAQHLPQIKEITEDLFAMAAGAGSSNGTGGMTTKLQAAQIATKSGVPVFICSSKEDTA
LLQAVTQANRGTLFLADDHAMNQRKQWMAFYARTDAAVEVDAGAVDAMLHQGRSLLATGV
KALEGDFEVGQVVEVYSQADHRLIGKGRVKLSSKDLQDQLANGRAEGVLIHRNDWVSL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaacaattgtatttaaggtcgggacaagttctctgacgcaagaaaatggc
agtctggaccgtatcaagatcgctcggattaccaatcagctggctcagttgcaccagaaa
ggttaccagattgtgctggtgacgtcgggctcgattgctgctggttttcggagattggga
tttgacaagcgaccgaccaagattgcggagaagcaggcttctgcggccgttggacaaggt
ttgctgattgaggaatatacgcaaaatctaatgaaggacggcatcgtatcggctcagatt
ttactgacccaggatgattttgcggatgccagacgttatcagaatgcctctcaagccttg
caggtcttgctcaagcaacgggctattcctattataaatgaaaatgataccattgccatt
gaggagattaaggtgggggataacgatactttatctgctcaggtggcttctctcttgaaa
gcagacctattggtgctcttgacggatgtggatggactttacactgccaatcctaacagc
gatccgactgcccagcacttgcctcaaattaaggagattacggaagatttatttgccatg
gcagcaggagcaggctcgtccaatggaacaggtggcatgaccaccaaattgcaggcggcc
cagattgcgaccaagtcaggcgtgcccgtctttatctgctcttcaaaagaggataccgcc
ctcttgcaggcggtcacccaagccaatcgtggaacgctctttttagcagatgaccatgcc
atgaaccaacgcaagcagtggatggccttctatgctcggacagacgcggcggttgaagtg
gatgcaggagcggttgatgctatgttgcaccagggccgcagtttgttagctactggtgtc
aaagccctcgaaggagactttgaagtgggccaggtcgtagaagtttacagccaagcagac
catcgtttgattggtaaaggtcgggtcaaactgtcctccaaggacttgcaggaccagttg
gcaaatggcagagcagagggcgtgttgattcaccgcaacgattgggtgagcttatag

DBGET integrated database retrieval system