KEGG   Streptococcus suis SC070731: NJAUSS_0954Help
Entry
NJAUSS_0954       CDS       T02536                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ssus  Streptococcus suis SC070731
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssus00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NJAUSS_0954
Enzymes [BR:ssus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NJAUSS_0954
Exosome [BR:ssus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NJAUSS_0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1014969..1016819
Genome map
AA seq 616 aa AA seqDB search
MEIAMTEFTDLDLYYMNTGEHTTLYEKMGAHIIKERNKIIGTQFRVYAPNAREVFLVGNF
NEWQRSHSMEREIDGVFQLYVDGLKSLEDYKYLIITHDGREIYKADPYAFFSQVRPDTAS
TTYNSRYKFKDDIWMYNRVNYDFKEQPVSIYEVHLGSWKQKFANKNEGGAPVEAFNSYKE
ITPLLIEHIKENNYTHIELLPITEHPLDASWGYQVTGYYSPTSRYGKPDELKYLVDQCHQ
AGIGVILDWVPLHFCKDAHGLYQFDGSWLYEYSYEQDRENHQWGTANFDLGKGLTRSFLL
SNLKYWLEYFHFDGIRVDALSYLLYWRGETDEDKINHAAIDFIKRVNAMVHTDYKGVLMI
AEDSSSFPKVTHPLEDGGIGFDMKWDLGWMNDTLKFVERPAIYRKYHSNEITFGMYYNQN
EQFLLPLSHDEVVHGKHSIIEKMNGDYEDKFHLARVYYSFYFAHPGKKLLFMGNEWGHIR
EWHEYTEMDWGLLQFPIHHSFYQMMKTLSTFYKEHDAFWKYDYQAYEKGFNWVKIDEEAS
LYAFSRTSDVQEILTIHNFNDQELFDVHLDLPADSEYKLVFSSNAIPMDTFSLYPDENGA
RITVPRLTSFYLERVK
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggagattgctatgacagaatttactgacctagatttatattatatgaatactggtgag
cataccactctttacgaaaaaatgggtgctcatattataaaagaacgaaacaaaattatc
ggaacccaatttcgtgtctatgccccaaatgccagagaagtattcttagttggcaacttt
aacgagtggcaacgcagtcactctatggagcgtgaaattgatggagtatttcaactttat
gtagacggattaaaatcccttgaagattataaatacctgattatcacacacgatgggcgt
gaaatatataaggctgacccttatgcatttttcagccaagttcgtccagacactgcctct
acaacctacaattcgcgttataaattcaaagatgacatctggatgtataatcgtgttaac
tatgattttaaagaacagccagtatccatctacgaggtgcacttaggttcgtggaagcaa
aaatttgctaataaaaatgaaggaggagctcctgtagaagctttcaatagttataaggaa
attactccacttctcatcgaacatatcaaggaaaataactacacacatattgagttattg
ccaattaccgagcatcctctcgatgcgtcttggggctatcaggtaacaggctactacagt
ccaactagtcgctatggcaagccagatgaacttaagtatttagttgaccaatgtcaccaa
gcaggaatcggagtgattcttgactgggtaccacttcatttctgtaaagatgctcatggg
ctctaccagtttgatggtagttggctatacgaatactcctacgaacaagaccgtgaaaat
caccagtgggggactgctaattttgaccttggaaaaggactgactcgttctttccttctt
tctaatttaaaatactggttggaatatttccattttgatggcatccgtgttgatgcacta
tcttatctcctctattggcgtggtgaaacagatgaagataagataaatcatgccgcaatt
gactttatcaaacgtgtcaatgccatggtccataccgactataagggagtcttgatgatt
gctgaagactcttcaagcttccctaaagtcacacatcctctagaagatggcggtattgga
tttgatatgaaatgggatctgggctggatgaatgatacactaaaattcgtggaacgccct
gctatttatcgaaaatatcactcaaatgaaatcacttttggtatgtactataaccaaaac
gagcaattcttactaccactttcgcacgacgaagttgttcatgggaaacactccattatc
gagaagatgaatggcgactacgaagataagttccatctggctcgagtctactacagcttt
tactttgcccatcctggaaagaaattactcttcatgggaaatgaatggggtcacatccgt
gaatggcacgaatatacagaaatggactggggactgctacaatttccaatccaccattct
ttctatcaaatgatgaaaacactatctactttctataaagaacatgatgctttctggaaa
tatgactaccaagcctatgaaaaaggatttaattgggtaaaaatagatgaagaagcaagc
ctgtatgctttttctcgcactagtgatgtgcaagaaatcttgactattcataactttaat
gatcaagaactatttgatgtacacttggatttgccagctgacagcgaatataaacttgtc
ttctcatctaatgctattccaatggacacatttagcctctatcccgatgaaaatggagcc
agaattactgtaccacgtttgaccagtttttatctagagcgtgtgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system