KEGG   Streptococcus suis SC070731: NJAUSS_1298Help
Entry
NJAUSS_1298       CDS       T02536                                 

Definition
Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ssus  Streptococcus suis SC070731
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ssus03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1382915..1383742)
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRRGLNRLVKGKVISKVEVTYAPMIKTGVDAFCQDLIGQEILDVDRRGKYL
LIYLTDHVLISHLRMEGKYNFFADQVPANKHFHAFFTFIDGSTLVYQDVRKFGTMELLGK
ADVDAYFISRKIGPEPTEEDFDLEEFAKKLAKSKKPIKSHLLDQSLVAGLGNIYVDEVLF
KAKVHPAQTSNQLSTDQVADLRQATIEVLQLGIEKGGSTIRTYKNALGMDGTMQDYLQVY
GKTGQACPRCQTEIVKIQLGGRGTHFCPKCQVKHG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgaattgcctgaggttgagacggttcgtcgtggtttgaatcgtttggtcaaggga
aaagttatttccaaggtggaggtgacctatgctcccatgattaagacaggtgtggatgcc
ttctgccaagacttgattggtcaggagattttagatgtggaccgtcgtggcaagtatctc
ttgatttacctgacagaccatgtcctcatttctcatttgcggatggaaggtaagtacaat
ttctttgctgaccaggtgcctgccaacaaacatttccatgccttttttacttttatagat
ggctcgaccttggtctatcaagatgtccgcaagtttgggaccatggaactgctgggtaag
gcagatgtggatgcctattttatcagtcgaaaaattggtcctgagccgacggaggaagat
tttgacttagaagaatttgccaaaaagttagctaagtcgaaaaagcccattaagtcgcat
cttttggaccagtctttggtggctggtttgggcaatatttatgtcgatgaggtcttgttc
aaggccaaagttcatcctgcacaaacgagtaatcagctgtcgacagatcaggtggcagac
ctccgtcaagccaccattgaagtcctgcaactgggtattgaaaaaggtggttcaaccatt
cggacttacaaaaatgccttgggcatggatgggactatgcaggattatttacaagtttac
ggaaagacagggcaggcctgtccccgttgccagacagagattgtcaaaatccagctgggc
ggacgggggacacatttctgtcccaagtgtcaggtgaaacatggctaa

DBGET integrated database retrieval system