KEGG   Streptococcus suis SC070731: NJAUSS_1436Help
Entry
NJAUSS_1436       CDS       T02536                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ssus  Streptococcus suis SC070731
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssus00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NJAUSS_1436
Enzymes [BR:ssus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     NJAUSS_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1524297..1525745)
Genome map
AA seq 482 aa AA seqDB search
MKIKNQAMLITYSDSLGKNLKDLKKVLEGPLKDVVGGIHILPFFPSSGDRGFAPMDYTKV
DPAFGDWSDIEALSKDYYLMFDFMINHISAKSPYFLDFLEKKDESAYADLFIRYKNFWPN
GEPTQEDVDLIYKRKPRAPYRIATFADGSEEKVWCTFDEQQIDLDVTTETTRRFIQENLE
QLAEHGASIIRLDAFAYANKKIGTNCFFVEPDIWEMLHFPRQLLAPKDVEILPEIHEHYT
IQQKIAEQDYYVYDFALPMLVLHALYSGHVNRLVHWMEICPRKQFTTLDTHDGIGVVDVK
DLLTDEETEETREALYAQGANVKKIYSTEAYNNLDIYQINCTYYSALGNNDQAYLLARVL
QCFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYDLEEIEQEVQRPVVQSLFKLL
KFRNTSPAFDGEFSVKMLDETSMEIFWNNQDAGVSARLTANLKEKSFEIVEIEEGKITTI
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaatcaagctatgttaattacctattcggatagtttaggcaagaatctt
aaggatttgaaaaaagttcttgaggggccgttaaaggatgttgtgggaggtatccatatt
ctgccgtttttcccatcatcaggtgaccgtgggtttgcgccaatggattatacaaaggtg
gaccctgcatttggagattggtcagatattgaagcactaagcaaagactattacctcatg
tttgattttatgatcaatcatatttcagcaaaatctccttatttccttgattttcttgaa
aagaaagatgaatcagcttatgcggatttgtttattcgttataaaaacttttggccaaat
ggtgagccaacgcaagaagatgttgatttgatttataagcgtaaacctcgcgcaccttat
cgaattgcaacatttgctgatggtagtgaagagaaggtgtggtgtacctttgatgaacag
cagattgatttagatgtgacaacggagacaacccgtcgtttcatccaagaaaatttggaa
cagttggcagagcatggtgcttcgattattcgtttggacgcctttgcttatgccaataaa
aaaatcggaaccaattgtttctttgtggagcctgatatttgggaaatgctccattttcca
cgtcagttattggcaccaaaagatgtagaaatcttaccagaaattcatgaacactacacc
attcagcagaaaattgccgagcaagattattatgtttatgattttgccttgccaatgcta
gttctccacgctttgtattctggtcatgtcaatcgcctggttcactggatggagatttgc
cctcgcaagcaatttacaactcttgatacacatgatggaatcggtgttgtggatgttaag
gatttgctgacggatgaggagacagaggagacccgtgaagccttgtatgcacaaggtgcc
aatgtgaagaaaatttatagtacagaagcctataataatttggatatttatcagattaac
tgtacttattattctgctcttggcaataatgatcaagcttatctattggcgcgtgttctc
caatgctttgcaccaggtattccacagatttattatgttggtttactagcaggcgaaaat
gatattgaacttttagaatcaagtaaggaagggcgcaatatcaatcgccattactatgat
ttggaagaaattgagcaggaagtgcaacggccagttgtacaatccttgttcaaactcctt
aaattccgcaatacaagtccagctttcgacggggagttctctgttaagatgttggatgaa
acaagtatggaaattttctggaataatcaagatgcaggggtgtctgcccgtctaacagca
aacctaaaagaaaaatcctttgaaattgttgaaattgaagagggaaaaattaccacaatt
gagttataa

DBGET integrated database retrieval system