KEGG   Streptococcus suis TL13: TL13_0418Help
Entry
TL13_0418         CDS       T02672                                 

Gene name
malM
Definition
4-alpha-glucanotransferase (amylomaltase)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ssut  Streptococcus suis TL13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssut00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TL13_0418 (malM)
Enzymes [BR:ssut01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TL13_0418 (malM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
415707..417215
Genome map
AA seq 502 aa AA seqDB search
MTNRTSGILMHITSLPGKFGIGTFGQSAYDFVDFLVETKQTYWQILPLTTTSYGDSPYQS
FSAIAGNTHLIDFDLLVEDGLLATEDFQDVNFGDNPEKVDYALIYQVRRPILEKAVQAFL
QDDKKKAAFLEFEKANSSWLTDYAEFMAIKEYFGNKALQEWEDKKVVARNEEALDKYRLE
LANQIDYYKVTQYFFFSQWKQLKEYANKHHIKIIGDMPIYVSADSVEVWTKPQLFKLDSE
RKPLYVAGVPADNFSADGQLWGNPIYDWPEHEKTGYNWWIYRIHESFKLYDVLRIDHFKG
FSDFWQVDGKAEVAKVGTWEPGPGYNLFKAVKETLGDLPIIAEDLGNIDAKARKLLADCG
YPGMKILEFGFFDVTGKSIDAPHRCIPNSVAYTGTHDNEVVNGWYNNLDPEQQEYVDAYS
NRKPIEKVSQAMLRMLFATVSDTAIATMQDVLDLGEESRMNMPSTIGGNWEWRMKAEDLT
QERKDFLTKMTLLYQRGNENHD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcgtaccagtggaattttgatgcatattacctcacttccaggtaagtttggt
attggtacttttggacagtctgcctatgattttgtagatttcttggtggaaaccaagcaa
acctactggcagattttaccactaacaactacaagctatggagattctccttaccagtct
ttctctgctattgcaggaaatacacacttgatagactttgacctcttggttgaagatggc
ttattggcaacagaagatttccaagatgtaaattttggagataatcctgaaaaagtagac
tatgctcttatctatcaagttcgccgaccaattttggagaaggcagttcaagcattttta
caagatgataagaagaaagctgcttttctagagtttgaaaaggctaactcatcttggttg
acagattatgctgagttcatggctatcaaggaatactttggtaataaagctctccaagaa
tgggaagataaaaaagttgtagctcgcaacgaggaagctcttgataagtaccgcttagaa
ttggcaaatcaaatcgactactacaaagtcacacagtatttcttcttcagccaatggaaa
caattgaaagaatatgctaacaaacaccacatcaaaatcatcggagacatgccaatctat
gtttctgctgatagcgttgaagtgtggacaaaaccacaactattcaaattggacagtgaa
cgcaagccgctttatgtagcaggtgtaccagctgataacttctcggcagatggtcaatta
tggggaaatcctatttacgattggccagaacatgaaaaaacaggctataactggtggatt
tatcgtatccatgaaagtttcaaactttatgatgtccttcggattgaccatttcaaaggt
ttctcagacttctggcaagttgatggtaaggcagaagtagctaaggttggtacctgggaa
ccaggtcctggctacaatctcttcaaggctgtcaaagaaacacttggagaccttccaatc
attgcagaagaccttggaaacattgacgctaaagctcgcaaattgcttgcggattgtggc
tatccaggcatgaaaatcttagaatttggtttctttgatgtaacaggtaagagtatcgat
gctccacaccgttgcattccaaattcagttgcctacactggaactcacgataatgaggtt
gtcaatggctggtacaacaatcttgatccagaacaacaagaatacgtggacgcctatagc
aaccgtaagccgattgaaaaagttagccaagctatgctccgtatgctgtttgcaacagtg
agtgatacagctattgcaaccatgcaagacgtcctagacttgggtgaagaaagtcgaatg
aatatgccgtcaactatcggtggaaactgggaatggcgcatgaaagctgaagacttgacc
caagaacgcaaagacttcttgaccaaaatgacattactataccaacgaggaaatgaaaac
catgactaa

DBGET integrated database retrieval system