KEGG   Streptococcus suis TL13: TL13_1213Help
Entry
TL13_1213         CDS       T02672                                 

Gene name
proB
Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ssut  Streptococcus suis TL13
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ssut00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TL13_1213 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TL13_1213 (proB)
Enzymes [BR:ssut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TL13_1213 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1237725..1238204)
Genome map
AA seq 159 aa AA seqDB search
MTEKTIVFKVGTSSLTQENGSLDRIKIARITNQLAQLHQKGYQIVLVTSGSIAAGFRRLG
FDKRPTKIAEKQASAAVGQGLLIEEYTQNLMKDGIVSAQILLTQDDFADARRYQNASQAL
QVLLKQRAIPIIQXKXIXLPLRRLRWETMIPCLLRWLLS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaacaattgtatttaaggtcgggacaagttctctgacgcaagaaaatggg
agtttggaccgtatcaaaatcgctcggattaccaatcagctggcacagttgcaccagaag
ggttatcagattgtactagtaacatctggttcaatcgctgctggttttcggagattgggc
tttgacaagcggccgactaagattgcggagaaacaggcttctgcggcggttggtcagggc
ttgctgattgaggaatatacgcaaaatctaatgaaggacggcatcgtatcggctcagatt
ttgctgacccaggatgattttgcggacgccagacgttatcagaatgcctctcaagccttg
caggtcttgctgaagcagcgtgctattcctattatccaakgaaaaawgataycwttgcca
ttgaggagattaaggtgggagacaatgataccctgtctgctcaggtggcttctctcttga

DBGET integrated database retrieval system