KEGG   Streptococcus suis 98HAH33: SSU98_0061Help
Entry
SSU98_0061        CDS       T00515                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64521..65111
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGILTKITAKYIVVETQGVGYILQVANPYAYSGQVQQEVTVYTHQVIREDAHLLY
GFATENEKSVFLSLISVSGIGPTTALAIIAVDDNDGLVRAIEQKNITYLTKFPKIGKKTA
QQMILDLEGKFVMSEEAGPVQQVAPSSENIALEEAMEAMEALGYRPAELKKIKKFFEGTN
DTAENYIKSALKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattaaaggaattttaacaaaaataactgcaaaatacattgtggtagaa
acgcaaggagtaggctatatcttgcaggttgctaatccctacgcctattcaggacaagtc
cagcaagaagtgactgtctatactcatcaggtgattcgtgaagatgctcatttgctctac
ggatttgctacagaaaatgaaaaatccgtctttctgagtctgatttcagtatcaggtatt
ggtccaacaacagctctggctattattgctgttgatgataatgatggacttgttcgtgct
atcgagcagaaaaacattacctacctgaccaaatttccaaagattggcaagaaaacagcc
cagcagatgattttggacttggaaggcaagtttgtcatgagcgaagaagcgggtcctgtt
caacaagtagcaccatccagtgaaaatatcgcccttgaagaagccatggaagccatggaa
gcccttggttaccgcccagccgaactcaagaaaatcaagaaattctttgaaggcaccaac
gacaccgcagaaaactacatcaagtcagcccttaaaatgctgatgaagtaa

DBGET integrated database retrieval system