KEGG   Streptococcus suis 98HAH33: SSU98_0222Help
Entry
SSU98_0222        CDS       T00515                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSU98_0222
Enzymes [BR:ssv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SSU98_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(210844..213411)
Genome map
AA seq 855 aa AA seqDB search
MEVRGTLFGLCEFFPTPFSLLLEINSMNEVYFTGTIDRIIFENPSNFYKILLLEIEETDA
DYDDYEIIVTGTIADVIEGEDYRFYGNLVTHPKYGQQLQISRYERSKPTSAGLVKYFSSE
HFKGIGRKTAEKIVELYGEDTIDKILAEPEKLTQITGLSSKNMQAFVEKLRLNYGTELIL
AKLAEYGIPNKLAFQIQDQYKEKTLQIIEENPYQLVEDVQGLGFTIADRIAENLGIASDS
PQRFRAGMLFSLIHRSMETGDTYVEARDLLEATLELLEKSRHTELDPAAVAKELTGLIAD
DKVQQEGTKIFDNSLYFAEHGIHTNLTRLMGKNGFKPFPRADVEAAIAELESISSLTYDN
IQKEAIVQAITNPLFILTGGPGTGKTTVINGIIAVYAILHKIDLTRNREECPVLLAAPTG
RATRRMNELTGLPSATIHRHLGLVEGQEESYRDDYLDADFIIVDEFSMVDTWLANQLFQN
ISSQTQVLIVGDAEQLPSVSPGQVLADLLKIDKLPSITLERIYRQSDDSTIVTLASQIRQ
GALPSDFREKKADRSYFEAQNEQIPALIERIVGAAIKSGIPANEVQILAPMYRGAAGIDQ
LNTMTQALLNPLEEGELEFLHNEQAFRQGDRVIHLVNDAEANVFNGDLGYITDLLPAKYT
DSKQDEITINFDGSEVTYPRNEWYKITLAYAMSIHKSQGSEFQVVILPITRTSHRMLQRN
LVYTAITRSKSKLILLGEISAFDYAVKNAGTVRKTYLVPRFQGEMAEQESKESLIKKDES
KTATTTQTQPPTQPDRKEQVKVVKENNQQLSLLDQDQPEKTSPQPTEYILTVDNLLTIDP
MIGIEQADIEEFFKA
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
ttggaagtgaggggaactctttttggtctatgcgagttcttccccactcccttttcatta
ttattggaaataaactctatgaacgaagtgtattttaccggtactattgaccggattatt
tttgaaaatcctagtaatttttataaaatccttctccttgaaatcgaggagacagacgca
gactatgatgactacgaaattattgtgaccggaacgattgccgatgtcattgaaggagaa
gactatcgtttctatggcaatctggtcacccatcccaagtatggtcagcagctgcaaatt
tcgcgttacgaacgcagcaagcctacctcagctggtctggtcaagtatttctccagcgag
catttcaagggaattggacgcaaaacagctgaaaaaatcgttgagctctatggcgaagat
accattgataagattttagctgaacctgaaaaactaacccaaatcacaggcctatccagc
aagaacatgcaggcatttgtcgaaaaactccgcctcaattatggaaccgagttgatcttg
gcaaaactagccgagtatggcattcccaataaattggcctttcaaatccaagaccagtat
aaggaaaaaacacttcagattattgaagaaaatccctatcaactggtcgaagatgtccag
gggctcggctttaccattgccgataggattgcggaaaatctaggaattgccagtgattca
ccccaacgttttcgggctggcatgctctttagtctcattcatcgctccatggaaacaggc
gatacctatgtggaggccagagacttgctggaagcaacccttgaactgctggaaaaatcc
cgccatacagagctggaccccgctgctgttgccaaagaattgacgggactgattgcagac
gacaaggtacagcaagaaggcacaaagatttttgacaacagcctctactttgccgaacat
ggtatccatacaaacctaactcgcctgatgggaaaaaacggcttcaagcccttcccacgc
gcagacgtcgaggctgccatagcagagctggaaagcatatcttctctcacctacgataac
attcaaaaagaagccattgtccaagccattaccaatccgcttttcattctgacaggcggg
ccagggactggaaaaacaacggttatcaacggcattatcgcagtctatgctatcttgcat
aagattgacctgacgcgaaaccgagaagaatgcccagtcctcctagccgctccaactgga
cgagcaaccagacggatgaatgaattgacagggctgccttccgccaccatccaccgccat
ctcggtctggtagaaggacaggaggaatcctaccgtgatgattatttggatgccgacttt
atcatcgtggatgagttttctatggtagatacttggttggcaaaccagctcttccagaat
atctcctcccagacccaagttctgattgtcggcgatgccgagcaattgccttctgtcagc
cccggtcaagtacttgctgacctcttgaaaattgacaagctgcccagcattactctagaa
cgtatctatcgtcaatccgatgattcgaccattgttaccctagccagccagattcgacag
ggtgctctgcctagcgattttcgtgagaaaaaggctgaccgttcctattttgaagcccag
aatgaacaaattccagccctgattgagcgcattgtcggcgcagccatcaagtcaggtatt
cctgcaaacgaggtacagatcctcgctcccatgtaccgtggggccgcaggcatcgaccaa
ctcaacactatgacccaggccctgctcaatccactggaagagggagagttagaattcctg
cataacgagcaagccttccgccaaggcgaccgggtcattcatttagtcaacgatgccgag
gccaatgtcttcaatggtgatttaggctacatcaccgacctccttcctgccaagtacacc
gactccaagcaggacgaaattaccatcaacttcgacggtagcgaggtcacctatccccga
aacgaatggtacaagattaccctggcctatgccatgtccatccacaagtcccaaggcagc
gagtttcaggtagtcatcctccccatcacccgcaccagccaccgtatgctccagcgcaat
ctggtctacaccgccatcacccgctccaagagcaagctcatcctcctgggcgaaatctcc
gccttcgactacgccgtcaaaaacgccggcaccgtccgaaaaacctatctggtcccacgt
ttccaaggggaaatggcagagcaggaaagcaaggaaagcctgattaaaaaagacgaaagc
aaaacagctacaaccacgcaaacccagccccctactcagccagacagaaaagaacaggtt
aaagtagtcaaagaaaacaaccaacaactctcccttcttgatcaagaccagccagaaaaa
acaagtccccaacccacagaatacattttgactgtagacaacctactaaccatcgacccc
atgattggcatagaacaggcagatattgaagaattttttaaagcataa

DBGET integrated database retrieval system