KEGG   Streptococcus suis 98HAH33: SSU98_0276Help
Entry
SSU98_0276        CDS       T00515                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSU98_0276
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSU98_0276
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSU98_0276
Enzymes [BR:ssv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSU98_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269567..270472
Genome map
AA seq 301 aa AA seqDB search
MRDTMTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDFSVLKDASYQDVA
KLILSAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLELFRGSTIAFKDMAL
SILPYLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQE
LQMTTQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQFSSANSMNIGRLVP
QIVYYVYAYAQLVKTGEIAAGDKVNFTVPTGNFGTSWQLITPNKSVCQLASSSVRPTTTM
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagggataccatgacattagtatatcaatcaacacgcgatgctaaaaatactgtatcg
gctagtcaagcgattttgcagggcttggcgaccgacggtggtttgtttacaccgctttct
attccaacagttgacttggatttttctgttttgaaagatgcttcttatcaagacgttgcc
aagctgattttgtcggctttcttggatgattttacggcagatgagttggactactgtatc
aataacgcctacgacagtaagtttgacacgtcagttattgccccagtggttaagctaaaa
ggtcagtacaacttggagctcttccgtggctcaaccattgccttcaaggatatggctctg
tccatcctcccttacttgatggcgacggcgactaaaaagcacggtttggaaaacgaaatt
gtcatcctgaccgcgacttcaggcgatacaggcaaggcagccatggctggttttgcggac
gttcctggcacacaaatcattgtcttctatccgcgtgacggggtatctaaggtccaagaa
ttgcagatgaccacgcagacaggggctaatacccacgtggtggctattgacggtaacttc
gacgatgcccagaccaatgtcaaacacatgttcaacgatgaggcactccgtgccaagttg
gcggctaagaaactccagttttcatctgccaactctatgaacatcggccgcttggtgcca
cagattgtttactatgtctatgcctacgctcagctggttaagactggtgagattgcggcg
ggcgacaaggtcaacttcaccgttccaacaggaaactttggaacatcttggcagcttata
acgccaaacaaatcggtctgccagttggcaagctcatctgtgcgtccaacgacaacaatg
tcctaa

DBGET integrated database retrieval system