KEGG   Streptococcus suis 98HAH33: SSU98_0276Help
Entry
SSU98_0276        CDS       T00515                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSU98_0276
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSU98_0276
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSU98_0276
Enzymes [BR:ssv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSU98_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269567..270472
Genome map
AA seq 301 aa AA seqDB search
MRDTMTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDFSVLKDASYQDVA
KLILSAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLELFRGSTIAFKDMAL
SILPYLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQE
LQMTTQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQFSSANSMNIGRLVP
QIVYYVYAYAQLVKTGEIAAGDKVNFTVPTGNFGTSWQLITPNKSVCQLASSSVRPTTTM
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagggataccatgacattagtatatcaatcaacacgcgatgctaaaaatactgtatcg
gctagtcaagcgattttgcagggcttggcgaccgacggtggtttgtttacaccgctttct
attccaacagttgacttggatttttctgttttgaaagatgcttcttatcaagacgttgcc
aagctgattttgtcggctttcttggatgattttacggcagatgagttggactactgtatc
aataacgcctacgacagtaagtttgacacgtcagttattgccccagtggttaagctaaaa
ggtcagtacaacttggagctcttccgtggctcaaccattgccttcaaggatatggctctg
tccatcctcccttacttgatggcgacggcgactaaaaagcacggtttggaaaacgaaatt
gtcatcctgaccgcgacttcaggcgatacaggcaaggcagccatggctggttttgcggac
gttcctggcacacaaatcattgtcttctatccgcgtgacggggtatctaaggtccaagaa
ttgcagatgaccacgcagacaggggctaatacccacgtggtggctattgacggtaacttc
gacgatgcccagaccaatgtcaaacacatgttcaacgatgaggcactccgtgccaagttg
gcggctaagaaactccagttttcatctgccaactctatgaacatcggccgcttggtgcca
cagattgtttactatgtctatgcctacgctcagctggttaagactggtgagattgcggcg
ggcgacaaggtcaacttcaccgttccaacaggaaactttggaacatcttggcagcttata
acgccaaacaaatcggtctgccagttggcaagctcatctgtgcgtccaacgacaacaatg
tcctaa

DBGET integrated database retrieval system