KEGG   Streptococcus suis 98HAH33: SSU98_0409Help
Entry
SSU98_0409        CDS       T00515                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
ssv00230  Purine metabolism
ssv01100  Metabolic pathways
Module
ssv_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SSU98_0409
Enzymes [BR:ssv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SSU98_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 RsgA_GTPase NB-ARC
Motif
Other DBs
NCBI-ProteinID: ABP91567
Position
402694..403344
Genome map
AA seq 216 aa AA seqDB search
MKDLKGDIMKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQRPGEVDGV
DYFFRSREEFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVK
KKVPDGVFIFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALMREYDYAVVNDEV
PLAAERVKRIIEAEHFRVDRVIGRYDEMIREQIVER
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttaaaaggagatatcatgaaagagcgaggcttactcattgtcttttctggt
ccatctggtgttggaaaaggaacagttcgaaaggaaatttttgaaagctctgataataaa
tttgaatattctgtatccatgacgacacgtccacagagaccgggagaagttgatggagtt
gactatttcttccgtagtcgtgaggaatttgaagatttgattcgccagggtcaaatgttg
gaatatgcagagtacgttggaaattactatggaacacctctgacctatgtcaatgaaact
cttgataagggaattgatgtctttttagaaattgaagtacagggtgccctccaagtgaag
aaaaaggttccagatggggtgttcattttcttgacaccacctgacttggaggagttgcaa
gatcgcttgattggtcgcggaacggatagtgaggaagttattgctcaacgtatcgaacgt
gccaaggaagagattgccttgatgcgtgagtatgattatgcagttgtgaacgatgaagtt
ccgttggctgctgagcgtgtcaagcgtataatcgaagcagaacatttccgtgtagaccga
gtgattggtcgctacgatgaaatgattcgtgaacagatagtagaacgataa

DBGET integrated database retrieval system