KEGG   Streptococcus suis 98HAH33: SSU98_0443Help
Entry
SSU98_0443        CDS       T00515                                 

Definition
galactose mutarotase-like protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU98_0443
   00052 Galactose metabolism
    SSU98_0443
Enzymes [BR:ssv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SSU98_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436768..438135
Genome map
AA seq 455 aa AA seqDB search
MIEVKTFDEKAKLYCLENKNGMQVTLTDFGARVVEVLLPVEENGGLRNVSLAAKSDDDYR
KTDLYPGSTIVPVAGRISGAQAEIEGTSYHFTENEPGRTLHGGVDTANEQYWDVELDHER
NQVTFGMVLKDGFNGFPGDVRVKAIYCLTDKNELTVDYQAVSDKDTIFNPTNHIYFNLTG
DFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEDVTGTPFDFRDFAPFAQGFDSQYPQNVL
VKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPAVVIYTYNFPVEALACYHGVFSLEC
QALPNACNVDGFGSILLEQGEEFLSKTTYRFTLPKKMGTLTVLQFGFSCVFYKIWYNKPV
CFNRSRRKRKIMTNEQEFLKEFEAWVNTQVMVNEMAVEESRRVLEEDKDERAADAYIRYE
SKLDAYRFIQGKFANYHAGKGFHDLPDELFGQRHY
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagtaaaaacatttgatgaaaaagcaaaactgtattgcttggaaaacaagaat
gggatgcaggtaaccttgacggattttggtgccagagtggtggaagtgcttttgccagta
gaagaaaatggcggtctacggaatgtcagtttagctgccaagtcggatgatgattaccgt
aagacagatttgtaccctggttcaactattgtcccagtagcggggcgtatttcaggtgcc
caagctgagatagagggaacaagctaccatttcacagaaaatgaacctggtaggactcta
cacggtggggttgacacggcaaatgagcagtactgggacgttgagctagaccatgagaga
aatcaagtgacctttggtatggtcctaaaagatggttttaatggctttcctggtgatgtg
agggtcaaggctatttattgtttgacggataaaaatgaattgacagttgactaccaggct
gtatcggataaggatacgatttttaatccgaccaaccatatctatttcaacttgactggt
gattttcaacggtcagttgccgagcaccgtattaaaattgctgccaatcactatgctccg
cttggggaggataacctgccaacgggtgtcttagaagatgtgacagggacgccgtttgat
tttagagattttgcgccttttgctcagggatttgatagccaatatcctcaaaatgtgttg
gtaaaaggctatgaccacccatggttattggaagaggtggatattccggtagaagttttg
agtccagatgggaaaattggactcagtgtcaaaaccaaccagcctgcggtcgttatttat
acatataattttcctgttgaagctttggcctgttaccatggtgtctttagtttagagtgt
caggccttgccaaatgcatgcaatgtcgatggatttggttcgattttgttagaacaagga
gaagaatttttgtctaaaacgacctatcgttttacattgcctaaaaaaatggggactcta
actgtgttacagtttgggttttcttgtgttttctacaaaatatggtataataaaccggtg
tgtttcaatcgaagcaggcgaaagaggaaaataatgacaaatgaacaagaatttttaaaa
gaatttgaggcttgggtcaacactcaggtcatggtaaacgagatggcggttgaagaaagt
cgtcgtgtcttggaagaagacaaggatgagcgtgcagcggatgcttatattcgttatgag
agcaagctggatgcctatcgattcattcaagggaaatttgccaactaccatgctggcaaa
ggttttcatgatttgccagatgagttgtttggtcaaaggcattattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system