KEGG   Streptococcus suis 98HAH33: SSU98_0525Help
Entry
SSU98_0525        CDS       T00515                                 

Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU98_0525
   00051 Fructose and mannose metabolism
    SSU98_0525
   00562 Inositol phosphate metabolism
    SSU98_0525
Enzymes [BR:ssv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSU98_0525
Exosome [BR:ssv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSU98_0525
  Exosomal proteins of bladder cancer cells
   SSU98_0525
  Exosomal proteins of melanoma cells
   SSU98_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
514867..515619
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTADQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaacaaaaatcctcaagaagca
caagctttcgttgaggcaattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttatggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gtagaatttgtaggtgctcaagtttctgcagctttgaaagacttgactgctgatcaagta
gcatcacttgttattgcttatgagccaatctgggcaatcggtactggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgttcgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system