KEGG   Streptococcus suis 98HAH33: SSU98_0538Help
Entry
SSU98_0538        CDS       T00515                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ssv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssv01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssv00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ssv00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ssv00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssv00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ssv00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
527073..527381
Genome map
AA seq 102 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMVAGDIHELSARSVGDI
ISRGGTFLCSARYPEFAKLEGQLKGIEQLEKTWYRRCSCYRW
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggtgatgcccctggtatgaacgctgctatt
cgtgcagttgttcgccaagcaatttcagaaggaatggaagtttatggaatcaacgaaggt
tacgcaggtatggttgcgggtgatatccatgaattgtctgcacgttctgtaggtgatatt
atttcacgtggaggaacattcctttgttcagctcgttatccagaatttgccaaattagaa
gggcaacttaaagggattgagcaacttgaaaaaacatggtatcgaaggtgtagttgttat
cggtggtga

DBGET integrated database retrieval system