KEGG   Streptococcus suis 98HAH33: SSU98_0538Help
Entry
SSU98_0538        CDS       T00515                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSU98_0538
   01230 Biosynthesis of amino acids
    SSU98_0538
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU98_0538
   00030 Pentose phosphate pathway
    SSU98_0538
   00051 Fructose and mannose metabolism
    SSU98_0538
   00052 Galactose metabolism
    SSU98_0538
  Energy metabolism
   00680 Methane metabolism
    SSU98_0538
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SSU98_0538
Enzymes [BR:ssv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSU98_0538
Protein phosphatases and associated proteins [BR:ssv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSU98_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
527073..527381
Genome map
AA seq 102 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMVAGDIHELSARSVGDI
ISRGGTFLCSARYPEFAKLEGQLKGIEQLEKTWYRRCSCYRW
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggtgatgcccctggtatgaacgctgctatt
cgtgcagttgttcgccaagcaatttcagaaggaatggaagtttatggaatcaacgaaggt
tacgcaggtatggttgcgggtgatatccatgaattgtctgcacgttctgtaggtgatatt
atttcacgtggaggaacattcctttgttcagctcgttatccagaatttgccaaattagaa
gggcaacttaaagggattgagcaacttgaaaaaacatggtatcgaaggtgtagttgttat
cggtggtga

DBGET integrated database retrieval system