KEGG   Streptococcus suis 98HAH33: SSU98_0540Help
Entry
SSU98_0540        CDS       T00515                                 

Definition
6-phosphofructokinase
Organism
ssv  Streptococcus suis 98HAH33
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
527817..527960
Genome map
AA seq 47 aa AA seqDB search
MVISNVGGSPTARDRVLASRMGVHAVKLLKEGRGGLSLGIRNEQMVV
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
ttggtcatatccaacgtcggtggttctccaacagcgcgtgatcgtgtactcgcttctcgt
atgggtgttcatgccgttaaattgcttaaagaaggccgtggaggtctttcgttaggtatc
cgtaacgagcaaatggttgtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system