KEGG   Streptococcus suis 98HAH33: SSU98_0646Help
Entry
SSU98_0646        CDS       T00515                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SSU98_0646
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SSU98_0646
Enzymes [BR:ssv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSU98_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
628621..629148
Genome map
AA seq 175 aa AA seqDB search
MKWNIYSLILTRGGYIMSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKEL
QELYDSYKDNGFVVLDFPCNQFLNQAPGSAEDINQICSLNYGTTFPRFAKIAVNGSEASP
LYRYLKKEKSTLLGGRIEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggaacatttattcacttattttgactagaggaggatatataatgagcatttat
gattttacagtacaaaaacaagatggcacagaccagtccatggctgagtatcaaggacaa
gttttacttatagtcaatacagcgccaggttgtggattggcaccacaatacaaggaacta
caggagctatatgatagctataaagacaacggttttgtagtgttggatttcccttgtaat
caatttttaaatcaggctcccggttctgcggaagacatcaatcagatctgtagcttgaat
tatggtacaacttttcctcgttttgctaaaattgctgtgaatggatctgaagctagtccg
ctatatcgctatcttaagaaagaaaaatcaaccttattaggaggtcgaattgagtggaat
tttaccaagtttttggtggatagacaagggcgtgtggtcaaacgatatttaccaacaact
agtccattaaaacttaaagaggatattgaactttacctagaaaaataa

DBGET integrated database retrieval system