KEGG   Streptococcus suis 98HAH33: SSU98_0721Help
Entry
SSU98_0721        CDS       T00515                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSU98_0721 (glpK)
Enzymes [BR:ssv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SSU98_0721 (glpK)
Exosome [BR:ssv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSU98_0721 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
700257..701816
Genome map
AA seq 519 aa AA seqDB search
MEAFSKKDKQTGGRPMSTEKYIMAIDQGTTSSRAIIFNKKGEKVGSYQKEFTQIFPKPGW
VEHNANEIWNSVQSVIAGSFIESGVRPDQIEGIGITNQRETTVVWDKETGLPIYNAVVWQ
SRQTAHIADQLKADGHADMIHQKTGLVVDAYFSATKVRWILDQVPGAQERAEKGEILFGT
IDTWLVWKLTDGKCHVTDYSNAARTMLYNIEELKWDDEILSLLNIPKAMLPEVRSNSEVY
GTTAPFHFYGAEVPISGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIVMNTGEEMQLSQN
NLLTTIGYGIGGKVYYALEGSIFIAGSAVQWLRDSMRMVTTSPESEELARKSTSNDEVYV
VPAFTGLGAPYWNSDARGSVFGLTRGTTKEDFVKATLQSIAYQVRDVIDTMQLDTGIDIS
VLKVDGGAAMNSLLMQFQADILGIEIARAQNLETTALGAAFLAGLAVGFWKDLDELKELN
AVGQSFQPTMNEARKEQLYKGWKKAVAATQLFAEVDEEQ
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgttttcaaaaaaagataaacaaacaggagggagacctatgtctactgaaaaa
tatatcatggccattgaccaaggaactacaagttcacgtgccattatcttcaataaaaaa
ggtgaaaaggttggcagttaccaaaaagagtttacgcaaattttccctaaaccaggttgg
gttgaacacaacgccaatgaaatttggaattctgttcagtctgtgattgcagggtccttt
atcgaaagcggtgttcgtcctgatcagattgaaggaattggtattaccaaccagcgtgaa
acaaccgttgtctgggataaggaaacaggtcttccaatctacaatgccgttgtctggcaa
tctcgtcaaacagctcatattgctgaccagctgaaggcggatggtcatgcagatatgatt
catcaaaagacaggtctagtagtcgacgcctacttctcagcaaccaaagttcgttggatt
ttagatcaagtccctggagcgcaggaacgtgctgaaaaaggtgagattctctttggaacc
attgatacttggttggtttggaaattgactgatgggaaatgccatgtgacggattattca
aacgcagctcgtaccatgctctacaacattgaagagttgaaatgggatgatgaaatttta
tctcttctcaatattccaaaagccatgctgccagaagttcgttcaaactctgaagtttac
ggcacaacagctccattccatttctatggcgcagaagtgccaatctctggcatggcaggt
gaccaacaggctgccttatttggacaattagcatttgagccaggtatggtgaaaaatact
tacggaaccggttccttcatcgtgatgaatacaggtgaagagatgcagttgtcacagaac
aaccttctcacaacaattggctatggtatcggtggcaaagtctattatgcgcttgaagga
tctatctttatcgctggttcggcggttcaatggctccgtgacagcatgcgaatggtgact
acatcacctgagtcagaagagcttgctcgtaagtctaccagcaatgatgaagtctatgtt
gttccagcctttacaggacttggtgctccgtattggaactcagatgcgcgtggctcagtc
tttggtctcactcgtggtacgactaaagaagacttcgtcaaagcaactcttcaatccatt
gcctaccaagttcgagatgttattgacaccatgcaattggatacaggtattgatatttct
gtcttgaaggttgacggtggtgcagcaatgaacagcctcctcatgcaattccaagcagat
attttgggtattgaaatcgcacgcgctcaaaaccttgaaactacagctcttggagcagca
ttcttagcaggtttagcagttggtttctggaaagatttggatgaattgaaagaactcaac
gctgtcggccaatccttccaaccaaccatgaacgaagctcgtaaagaacaactttacaag
ggatggaaaaaagctgtcgcagcaactcaactatttgcagaagtggatgaagagcaataa

DBGET integrated database retrieval system