KEGG   Streptococcus suis 98HAH33: SSU98_0722Help
Entry
SSU98_0722        CDS       T00515                                 

Definition
alpha-glycerophosphate oxidase
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SSU98_0722
Enzymes [BR:ssv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SSU98_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701883..703721
Genome map
AA seq 612 aa AA seqDB search
MNRMEFSKETRRLAIERMQDRQLDLLIIGGGITGAGVALQAAASGMETALIEMQDFAEGT
SSRSTKLVHGGLRYLKQFDVEVVSDTVSERAVVQNIAPHIPKPDPMLLPVYDEPGSTFSL
FRLKVAMDLYDLLAGVNNTDMANKVLTREEVLEREPNLKQEGLIGGGVYLDFRNNDARLV
IENIKRAAKDGALIASRAKAEKFIKDDAGKVVGIVARDLLTDRTFEIRARLVINTTGPWS
DEVRNLGGEGSGVLQMRPTKGVHLVVDSSRLSVPQPTYFDTGHADGRMVFVLPRENKTYF
GTTDTDYTGDLANPMVTQEDVDYLLDIVNNRFPEANLTLDDIESGWAGLRPLLSGNGASD
YNGGNNGKLSDDSFNSLIETVKGYMNNEKTRDDVEHDLTHLEGSVSEKHLDPSAVSRGSA
LDRDDNGLLTLAGGKITDFRKIAEGAIEKVADILKEEHGRSFKLINSKTYPVSGGELNPA
NVAEEIEHLAQLGVKKGLLYDDALYLANLYGSNAPKVFVLNHKVEAVSGLNKRDLLSLHY
AMKEEMTLTAVDYLLRRTNYMLFMREQLDAVALEIIKEMAAYYAWSEEEVAQQKQLLADT
LVKNDLTYLKEK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgtatggaattttcaaaagaaacaagacgcttagctattgagcgaatgcaggat
cgtcaacttgacctcctcattatcgggggtggtattacaggtgcaggtgtggctttgcag
gcagcagcaagcggtatggaaacagccttgattgaaatgcaggactttgcagaaggaact
tccagtcgctcaaccaaattggtccacggtggtcttcgctacctcaaacaatttgacgtg
gaagtggtatccgataccgtatctgaacgtgctgtagtacaaaatatcgccccacatatt
ccaaagccagacccaatgcttttaccagtctatgatgagccaggttctaccttcagcctc
ttccgtttgaaagtggccatggacttgtatgatctcttggctggcgtcaataataccgat
atggccaataaggtcttgacaagagaagaagtacttgaacgcgaaccaaacttgaagcaa
gaaggattgattggtggcggtgtctatcttgatttccgcaacaatgatgctcgtttggtt
attgaaaatatcaaacgtgcagccaaggatggtgccttgattgccagccgtgccaaagct
gagaaattcatcaaagatgatgctggaaaagttgtcggtatcgtcgctcgtgatttgctg
acagaccgcacctttgaaatccgtgcgcgtttggtcatcaatacaacaggaccatggagt
gatgaagtgcgtaatctgggtggagaaggttcaggcgttctccagatgcgtccgaccaag
ggtgtgcacctagttgtcgatagctctcgcttgtctgtaccacagccgacttactttgat
actggccatgcggatggtcgaatggtctttgtccttccgcgtgaaaataaaacctatttt
ggtacgactgatacagactatactggtgatttggcaaatccaatggtaacccaagaagat
gttgactacctgcttgatattgtcaacaatcgcttcccagaagcaaacttgaccctggat
gacattgagagtggttgggcaggtcttcgtcccctcttgtctggaaatggtgcttctgac
tacaatggtggaaacaacggtaagctcagcgatgacagctttaatagcttgattgaaacg
gtcaaaggttatatgaacaatgaaaagacacgtgacgatgtggaacatgatttgacccat
ctggaaggcagcgtttctgaaaaacacttggatccttcagctgtatcacgtggctctgcc
cttgaccgtgatgacaatggtttgctgactcttgctggtggtaagattactgacttccgt
aagatagcggaaggtgcaattgaaaaagtggcagacattctcaaagaagaacatggtcgc
agcttcaaactcatcaattctaagacctatccagtctctggtggtgaattgaaccctgca
aacgtagcagaagaaattgaacatcttgctcaactaggtgtgaagaaaggtctcctttat
gatgacgccctttacttggcaaacttgtacggttcaaatgctccaaaagtctttgtatta
aaccataaagtagaagccgtttctggcttgaacaagcgtgatttgctttcccttcactat
gctatgaaggaagagatgaccttgactgcagttgactatcttcttcgtcgtaccaactac
atgctctttatgcgtgagcagttggatgcagttgcgcttgaaatcattaaggaaatggca
gcttattatgcttggtcagaggaagaagttgctcaacagaaacaattgttggcagataca
cttgttaagaatgatttgacctatttgaaagaaaaatag

DBGET integrated database retrieval system