KEGG   Streptococcus suis 98HAH33: SSU98_0835Help
Entry
SSU98_0835        CDS       T00515                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSU98_0835
   00670 One carbon pool by folate
    SSU98_0835
Enzymes [BR:ssv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SSU98_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
812936..813421
Genome map
AA seq 161 aa AA seqDB search
MTKKIVAIWAQDENGLIGKGDRLPWSLPADLAHFKKTTTGHTMVMGRITFDGMGKRALPN
RHTIVLTTDKTYQLESERITILHSVEDVLDWYNKQEQTLFVIGGGQIFTAFAPYIETLIV
TDIHGQFNGDVYFPKAFPMEKFQLPSAIYVQIDEKTRMILQ
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagattgttgccatttgggctcaagatgaaaatggattgattggaaaaggt
gatagacttccttggtcattgccagctgacttagctcatttcaaaaaaacgacaacaggt
cacacgatggtgatgggacgtataactttcgacggcatgggtaaacgtgctcttcccaat
cgtcacaccatcgttttgacaacggataaaacctatcaactagagagtgaacgtattacc
attttacacagtgtggaagatgttctagattggtataacaaacaggagcagacactattt
gtgattggtgggggacaaatttttactgcttttgcaccttacattgaaacattaatagtg
acagatattcacggtcaatttaatggcgatgtgtattttccgaaagcatttcctatggag
aaatttcagctaccaagcgccatttacgtccaaatagacgagaaaacccgtatgatttta
caataa

DBGET integrated database retrieval system