KEGG   Streptococcus suis 98HAH33: SSU98_0918Help
Entry
SSU98_0918        CDS       T00515                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ssv00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(881511..883256)
Genome map
AA seq 581 aa AA seqDB search
MRLLIYMVNKYFFEKYSDKKIIFLTKNLYRTVSVNKTKIYCLEGYVEEVCSIIEQNAISS
FEETISVLQDHVINGLIIVEMAERIYIISPYLDSRLSWFENNKNIIFSDSAVEIAKYLKL
KLSTKRLASQFVFGLPYYPFQTISLWEELVNIKPLNYLEITEKGCLEKKIPSYEVDTKDF
NQLIIKIKEEFLNSINHDLNMGNEVSSDVSGGVDSATIAFTLNKMIPDFSILHAESSATA
NSDTKWATFIAKNLGRELKKFDSIEITEKRFAIEEGYINGIIPSFPLLWADSEGYLKSVI
TYQEGKKHPTHFLGIGGDELFTPMPSNPWSIVRQENLGGLLYALKYSLIMRRPFFSCLLD
LLDKRGYLETMTQNLEIVFNESSEPIKRELGWMDGLQVPSWLSEKSKKESQSFLNSLLFS
NSEPIITDRTTFQMIQSLIFQKSVLRQIQLTTNSIYWATPFLHKKLVEICLQIPAKYKVS
SKLTKPVLQKALKGIVPIEVFNRGFKGDYSDALYSGYREAVRKNFHKLEQFEVVKMGIVD
VEKLKLELSLPAGNPNKIDYFERLCSVERWIRQIKLYMKNE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
ttgaggttgttaatatatatggtaaataagtatttttttgaaaaatattctgataaaaaa
ataatattccttactaaaaatttatatagaactgtttctgtaaataaaacaaaaatctat
tgtttggaaggctatgtcgaagaagtatgctcaattatagaacagaatgctatcagtagt
tttgaagaaacaatatcagtacttcaggatcatgttataaatggtctaattattgttgaa
atggctgaaagaatatacattatttctccttatttagattcaagactatcttggtttgag
aataataagaatataatttttagtgattccgctgtagagattgcaaaatatctgaaatta
aaactttccacgaagcgtttagcgagtcaatttgtttttggacttccatattatccattt
caaacaattagcctctgggaagagctagtaaatataaaacctttaaactatttagaaata
accgaaaaaggttgtttagaaaaaaagattccaagttatgaagtagacactaaagatttt
aatcaactaataattaaaataaaagaagagtttttaaatagcattaatcatgatctaaat
atgggaaatgaagtgtcaagtgatgtatcaggaggtgttgattctgcgacaattgctttt
acactgaataaaatgataccggacttctctattttgcatgctgaatcaagtgctactgcc
aatagtgatactaaatgggcgacatttattgcaaaaaatcttggtagggagttaaaaaaa
tttgactctatagaaataacagagaaaagatttgcaatagaagaaggatatatcaatggt
attattccaagctttccattactgtgggccgattcagaaggatatttaaaatcagtgatt
acttatcaggaaggtaaaaaacatccgactcatttcctaggtattggtggtgatgaatta
ttcacaccgatgccttctaatccctggagtatagtccgtcaggaaaatttaggtggacta
ctttatgctctgaaatatagtttgataatgagaagaccattttttagttgcctattggat
ttgttagataagagaggatatttggaaaccatgacccaaaatttagaaattgtcttcaac
gaatcttctgaacctatcaaaagagaactggggtggatggatggactacaggtaccaagt
tggctcagtgaaaaatccaaaaaagaatcgcaaagttttttaaactcgttattattttcc
aattctgagccaataatcactgatagaacaacattccaaatgattcaatctttaatattt
caaaaatcagtgttgcgacaaattcaattaactactaattccatttattgggcaacacca
tttttacataaaaaattagtagaaatttgtcttcaaattccagcaaaatataaagttagt
tcaaagctaacaaaaccggtattgcaaaaagcattgaaggggatcgtaccaattgaagtt
ttcaacaggggttttaaaggcgattattcagatgccttatatagtggatatagagaagca
gttcgtaaaaacttccacaagttagaacaatttgaagtggtaaaaatgggaattgttgat
gttgaaaagttaaaattggagctgtcattacctgcgggaaatccgaataaaattgattat
tttgaaaggttatgttcggtagaacgttggattaggcagattaaattgtatatgaagaat
gagtga

DBGET integrated database retrieval system