KEGG   Streptococcus suis 98HAH33: SSU98_0918Help
Entry
SSU98_0918        CDS       T00515                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSU98_0918
Enzymes [BR:ssv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SSU98_0918
Peptidases [BR:ssv01002]
 Cysteine Peptidases
  Family C44
   SSU98_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(881511..883256)
Genome map
AA seq 581 aa AA seqDB search
MRLLIYMVNKYFFEKYSDKKIIFLTKNLYRTVSVNKTKIYCLEGYVEEVCSIIEQNAISS
FEETISVLQDHVINGLIIVEMAERIYIISPYLDSRLSWFENNKNIIFSDSAVEIAKYLKL
KLSTKRLASQFVFGLPYYPFQTISLWEELVNIKPLNYLEITEKGCLEKKIPSYEVDTKDF
NQLIIKIKEEFLNSINHDLNMGNEVSSDVSGGVDSATIAFTLNKMIPDFSILHAESSATA
NSDTKWATFIAKNLGRELKKFDSIEITEKRFAIEEGYINGIIPSFPLLWADSEGYLKSVI
TYQEGKKHPTHFLGIGGDELFTPMPSNPWSIVRQENLGGLLYALKYSLIMRRPFFSCLLD
LLDKRGYLETMTQNLEIVFNESSEPIKRELGWMDGLQVPSWLSEKSKKESQSFLNSLLFS
NSEPIITDRTTFQMIQSLIFQKSVLRQIQLTTNSIYWATPFLHKKLVEICLQIPAKYKVS
SKLTKPVLQKALKGIVPIEVFNRGFKGDYSDALYSGYREAVRKNFHKLEQFEVVKMGIVD
VEKLKLELSLPAGNPNKIDYFERLCSVERWIRQIKLYMKNE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
ttgaggttgttaatatatatggtaaataagtatttttttgaaaaatattctgataaaaaa
ataatattccttactaaaaatttatatagaactgtttctgtaaataaaacaaaaatctat
tgtttggaaggctatgtcgaagaagtatgctcaattatagaacagaatgctatcagtagt
tttgaagaaacaatatcagtacttcaggatcatgttataaatggtctaattattgttgaa
atggctgaaagaatatacattatttctccttatttagattcaagactatcttggtttgag
aataataagaatataatttttagtgattccgctgtagagattgcaaaatatctgaaatta
aaactttccacgaagcgtttagcgagtcaatttgtttttggacttccatattatccattt
caaacaattagcctctgggaagagctagtaaatataaaacctttaaactatttagaaata
accgaaaaaggttgtttagaaaaaaagattccaagttatgaagtagacactaaagatttt
aatcaactaataattaaaataaaagaagagtttttaaatagcattaatcatgatctaaat
atgggaaatgaagtgtcaagtgatgtatcaggaggtgttgattctgcgacaattgctttt
acactgaataaaatgataccggacttctctattttgcatgctgaatcaagtgctactgcc
aatagtgatactaaatgggcgacatttattgcaaaaaatcttggtagggagttaaaaaaa
tttgactctatagaaataacagagaaaagatttgcaatagaagaaggatatatcaatggt
attattccaagctttccattactgtgggccgattcagaaggatatttaaaatcagtgatt
acttatcaggaaggtaaaaaacatccgactcatttcctaggtattggtggtgatgaatta
ttcacaccgatgccttctaatccctggagtatagtccgtcaggaaaatttaggtggacta
ctttatgctctgaaatatagtttgataatgagaagaccattttttagttgcctattggat
ttgttagataagagaggatatttggaaaccatgacccaaaatttagaaattgtcttcaac
gaatcttctgaacctatcaaaagagaactggggtggatggatggactacaggtaccaagt
tggctcagtgaaaaatccaaaaaagaatcgcaaagttttttaaactcgttattattttcc
aattctgagccaataatcactgatagaacaacattccaaatgattcaatctttaatattt
caaaaatcagtgttgcgacaaattcaattaactactaattccatttattgggcaacacca
tttttacataaaaaattagtagaaatttgtcttcaaattccagcaaaatataaagttagt
tcaaagctaacaaaaccggtattgcaaaaagcattgaaggggatcgtaccaattgaagtt
ttcaacaggggttttaaaggcgattattcagatgccttatatagtggatatagagaagca
gttcgtaaaaacttccacaagttagaacaatttgaagtggtaaaaatgggaattgttgat
gttgaaaagttaaaattggagctgtcattacctgcgggaaatccgaataaaattgattat
tttgaaaggttatgttcggtagaacgttggattaggcagattaaattgtatatgaagaat
gagtga

DBGET integrated database retrieval system