KEGG   Streptococcus suis 98HAH33: SSU98_1030Help
Entry
SSU98_1030        CDS       T00515                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
ssv00500  Starch and sucrose metabolism
ssv01100  Metabolic pathways
ssv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSU98_1030
Enzymes [BR:ssv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SSU98_1030
Exosome [BR:ssv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSU98_1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ABP92188
Position
989375..990181
Genome map
AA seq 268 aa AA seqDB search
MVHTDYKGVLMIAEDSSSFPKVTHPLEDGGIGFDMKWDLGWMNDTLKFVERPAIYRKYHS
NEITFGMYYNQNEQFLLPLSHDEVVHGKHSIIEKMNGDYEDKFHLARVYYSFYFAHPGKK
LLFMGNEWGHIREWHEYTEMDWGLLQFPIHHSFYQMMKTLSTFYKEHDAFWKYDYQAYEK
GFNWVKIDEEASLYAFSRTSDVQEILTIHNFNDQELFDVHLDLPADSEYKLVFSSNAIPM
DTFSLYPDENGARITVPRLTSFYLERVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggtccataccgactataagggagtcttgatgattgctgaagactcttcaagcttccct
aaagtcacacatcctctagaagatggcggtattggatttgatatgaaatgggatctgggc
tggatgaatgatacactaaaattcgtggaacgccctgctatttatcgaaaatatcactca
aatgaaatcacttttggtatgtactataaccaaaacgagcaattcttactaccactttcg
cacgacgaagttgttcatgggaaacactccattatcgagaagatgaatggcgactacgaa
gataagttccatctggctcgagtctactacagcttttactttgcccatcctggaaagaaa
ttactcttcatgggaaatgaatggggtcacatccgtgaatggcacgaatatacagaaatg
gactggggactgctacaatttccaatccaccattctttctatcaaatgatgaaaacacta
tctactttctataaagaacatgatgctttctggaaatatgactaccaagcctatgaaaaa
ggatttaattgggtaaaaatagatgaagaagcaagcctgtatgctttttctcgcactagt
gatgtgcaagaaatcttgactattcataactttaatgatcaagaactatttgatgtacac
ttggatttgccagctgacagcgaatataaacttgtcttctcatctaatgctattccaatg
gacacatttagcctctatcccgatgaaaatggagccagaattactgtaccacgtttgacc
agtttttatctagagcgtgtgaaataa

DBGET integrated database retrieval system