KEGG   Streptococcus suis 98HAH33: SSU98_1156Help
Entry
SSU98_1156        CDS       T00515                                 

Definition
2-amino-4-hydroxy-6-hydroxymethylpteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1090294..1090782)
Genome map
AA seq 162 aa AA seqDB search
MKHVAYLSIGGNMGNRQAYLQAALDKLASHPGCQLGLVSNIYETPAWGKTDQADFLNLAC
QVYTDLSAQDFLSVFQNIEQELDRVRIEKWGQRTIDLDIIFWDEEKIQEENLIVPHPYAH
ERAFVLKPLAEIASDYCHPILKKVVSDLLAELGEQKDIKIFK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatgtagcctatctcagtatcggagggaatatgggcaatcgacaagcctattta
caggcagccctagacaaattagccagtcatccaggttgccagcttggcttagtttccaac
atttatgaaactccagcttggggcaagaccgaccaggctgatttcctcaatctagcctgt
caagtgtatactgatttgtctgctcaggattttctaagcgttttccagaacatcgaacaa
gagttggaccgagtacggattgaaaaatggggacaacggaccattgatttggatattatt
ttttgggatgaggagaagattcaagaagagaatctgattgttccccatccctacgcccat
gaaagagcatttgttctcaaacctcttgctgagattgcttctgattactgtcacccaatt
ttgaaaaaagtggtatcggacttgcttgcagaactaggggaacaaaaagatataaaaatt
ttcaaatag

DBGET integrated database retrieval system