KEGG   Streptococcus suis 98HAH33: SSU98_1370Help
Entry
SSU98_1370        CDS       T00515                                 

Definition
recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSU98_1370
DNA repair and recombination proteins [BR:ssv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SSU98_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1294987..1295394)
Genome map
AA seq 135 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMEDDVVNEFAKNLLAAKRDLSYCSIC
GNLTDQDPCAICQDSTRDQSTILIVEDSRDVTALENIQEYHGLYHVLHGLISPMNGIGPD
DINLKTLLTRLMENE
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgctttaccctacacctattgccaagttaattgatagctattctaaattgccaggtatc
ggtataaaaacggctacccgtttagctttttatactattggcatggaggatgatgtcgtt
aatgagtttgcaaaaaatttattggcagccaagcgagacctatcttattgctccatttgt
ggtaatttgacagatcaggacccctgtgccatttgccaggactcaacgcgagaccagtct
actattttgattgtagaggatagtcgagatgttacagccttggaaaatatccaagagtat
cacggtctctaccatgtattgcatggcttgatttcccctatgaacgggattgggccagac
gatattaacctgaaaactctgctgacccgcttgatggaaaatgagtga

DBGET integrated database retrieval system