KEGG   Streptococcus suis 98HAH33: SSU98_1370Help
Entry
SSU98_1370        CDS       T00515                                 

Definition
recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1294987..1295394)
Genome map
AA seq 135 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMEDDVVNEFAKNLLAAKRDLSYCSIC
GNLTDQDPCAICQDSTRDQSTILIVEDSRDVTALENIQEYHGLYHVLHGLISPMNGIGPD
DINLKTLLTRLMENE
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgctttaccctacacctattgccaagttaattgatagctattctaaattgccaggtatc
ggtataaaaacggctacccgtttagctttttatactattggcatggaggatgatgtcgtt
aatgagtttgcaaaaaatttattggcagccaagcgagacctatcttattgctccatttgt
ggtaatttgacagatcaggacccctgtgccatttgccaggactcaacgcgagaccagtct
actattttgattgtagaggatagtcgagatgttacagccttggaaaatatccaagagtat
cacggtctctaccatgtattgcatggcttgatttcccctatgaacgggattgggccagac
gatattaacctgaaaactctgctgacccgcttgatggaaaatgagtga

DBGET integrated database retrieval system