KEGG   Streptococcus suis 98HAH33: SSU98_1402Help
Entry
SSU98_1402        CDS       T00515                                 

Definition
threonine dehydrogenase and related Zn-dependent dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSU98_1402
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU98_1402
  Lipid metabolism
   00071 Fatty acid degradation
    SSU98_1402
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSU98_1402
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSU98_1402
   00626 Naphthalene degradation
    SSU98_1402
Enzymes [BR:ssv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSU98_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1334737..1335855
Genome map
AA seq 372 aa AA seqDB search
MNSKVYNIPYQSERTFINKCRCVENMKAAIYEKAGKMTVAEIEKPSLQAKDDVIIKVVRA
CVCGSDLWGYGEDIHHDHGDTNSGHEAIGIVEEVGEDITTLVPGDFVIVPFTHGCGHCDA
CRAGFDGTCDNHPGYTNWGNNYQSQYIRFHYGNWALVKIPGQPSDYSEGMIKSLLTLADV
MPTGYHATRVADVKPGDKVVVIGDGAVGQCAVIAAKMRGASQIIMMSRHADRQQMALESG
ATAVVAERGEEGIAKVREILGGGADAALECVGTEASIDQALGVLHNGGRIGFVGVPHYNN
HALGSTFAQNIIIGGGSASVTTYDKEILLDAVLKGDINPGRVFTQTYSLDNIDQAYKDMA
NRKTIKAMITVD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgaactccaaggtgtataatattccatatcaatcagaaaggacatttattaataaatgt
aggtgtgtagaaaatatgaaagcagctatttatgaaaaagccggtaagatgaccgttgca
gaaatcgaaaaaccaagccttcaagccaaagatgacgtcattatcaaggtcgttcgggcc
tgtgtctgtgggtcggacctttggggctacggagaagacattcaccatgaccacggtgac
acaaactctggtcatgaagccatcggtatcgttgaagaggtaggcgaagacattacaaca
cttgttcctggtgacttcgttatcgttccatttacacatggttgcggacactgtgatgcc
tgtcgtgctggctttgacggtacttgtgacaaccatccaggctacaccaactggggcaac
aactaccagtctcaatatattcgtttccactacggtaactgggccttggtcaaaattcct
ggtcagccaagcgactactcagaaggcatgatcaaatctctcttgactctggcagatgtt
atgccaacaggctaccatgctacgcgtgttgcagatgtcaaacctggtgataaggtggtt
gtcatcggtgatggtgcagtggggcaatgtgccgtcattgctgcaaaaatgcggggagct
tcgcagattatcatgatgagccgtcatgctgaccgtcagcaaatggctctggaatcaggg
gctactgctgttgttgctgaacggggcgaggaaggaattgccaaagtccgtgaaattctt
ggaggtggcgctgatgctgccctcgaatgtgtcggaacagaagcttctattgaccaagcc
ctcggcgtccttcataatggcggtcgcatcggttttgttggtgtgcctcattacaacaac
cacgccctcggatcaacttttgctcaaaatatcattatcggtggtggctctgcttctgtc
acaacctatgataaggaaattttgcttgatgctgttctcaaaggcgacatcaacccaggt
cgagttttcacccaaacttacagcctggacaatatcgaccaagcctacaaagacatggcc
aaccggaaaacgattaaagctatgattacggtggattaa

DBGET integrated database retrieval system