KEGG   Streptococcus suis 98HAH33: SSU98_1484Help
Entry
SSU98_1484        CDS       T00515                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ssv00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ssv00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1412582..1413925
Genome map
AA seq 447 aa AA seqDB search
MKINTALGILAGKSSQFILKKLGRGTTLPGKIALKFDKHILDSLAKDYEVVVVTGTNGKT
LTTALTVGILQEAFGEITTNTSGANMITGITATFLSAKKNKNGKKIAVLEIDEASLARVT
DFIKPSLIVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPQATILANGDSPLFNSTNVINP
VKYYGFATEEHEPRLAHYNTEGVLCPHCHQIIQYKLNTYANLGSYICTNCGFSRPELDYK
LTKLKEITNTSSTFVIDGQDYKINIGGLYNIYNALAAVSVAEFFGVSPEKIKAGFDKSKA
VFGRQETFKLGDKDCTLVLIKNPVGATQAIEMMKLAPYDFSLSVLLNANYADGIDTSWIW
DADFEQITQMDIPQVFAGGVRSSEIARRLRVTGYPENQITETPKLEDIMTLIEQSSSQHA
YILATYTAMLEFRDLLAQRQAVGKEMK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaatacagctttgggtattctagcaggaaaaagttcccagttcattttgaaa
aaactaggacgtggtactaccctacctggaaaaattgccctcaaattcgataaacatatt
ttagatagtttggctaaggattatgaagtcgttgttgtgacaggtactaacggaaagact
ctgaccaccgccctgacagttggtatcctccaagaagcctttggcgaaatcacgaccaat
accagcggtgccaatatgatcacaggaattacggcaacctttttgtctgccaagaaaaat
aaaaacggcaagaagattgccgtcttggagattgacgaagcaagtcttgcccgtgtaacc
gactttataaagcctagtctgattgtctttaccaatatcttccgtgaccagatggaccgc
tacggtgagatttataccacctaccagatgattttggacggggctgcaaaagctccgcag
gcaactattttggccaatggtgatagtccacttttcaactcaacgaacgttatcaatcca
gtaaaatactacggttttgcgacggaagagcatgagccacgtctggcccattacaatacc
gaaggcgttctctgtcctcattgccaccagattatccagtacaagctcaatacctacgcc
aacttgggtagctacatctgtaccaactgtggctttagccgacctgaactggactacaag
ttgaccaaactaaaagaaatcaccaatacttcttctacctttgtcattgacggtcaggat
tataagattaacatcggaggcctctacaacatctacaatgccctagcagctgtcagcgta
gcagaatttttcggcgtatctcctgaaaaaatcaaggcaggatttgacaaatcaaaggca
gtcttcggtcgccaagaaacatttaagttgggtgataaagattgtacattggtcttgatt
aaaaaccctgtcggtgcaacccaggctattgaaatgatgaaactggctccatacgatttt
agcctgtccgtccttctcaatgccaactacgctgacggaattgataccagctggatttgg
gatgctgactttgaacaaatcacccaaatggacattccacaagtctttgcaggcggtgtt
cgttcgtctgaaattgcccgtcgcctccgtgtgactggctatcctgagaaccagattact
gaaacaccaaaactagaagacatcatgaccttgattgagcaatcgagtagtcagcatgct
tatattttagctacttatacagctatgctcgaattccgtgacctgctggctcaacgccaa
gccgttggaaaggagatgaaataa

DBGET integrated database retrieval system