KEGG   Streptococcus suis 98HAH33: SSU98_1500Help
Entry
SSU98_1500        CDS       T00515                                 

Definition
Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssv  Streptococcus suis 98HAH33
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssv00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1427068..1428492)
Genome map
AA seq 474 aa AA seqDB search
MSIFPDNFLWGGAVAANQVEGAYNEGGKGLSVQDVLPNGGLGEATQEPTEDNLKLQAIDF
YHRYKEDIALFSELGFKVFRTSIAWSRIFPNGDEEFPNEEGLQFYDELFDELLKNGIEPL
VTLSHYETPLYLARKYHGWVDRKMIQFFEKFARTVFERYKDKVKYWLTFNEVNSVLELPF
TSGGIDLPNEELSKQDLYQAIHHELVASSLVTKIAHEIIPDCKVGCMVLAMPTYPMTPNP
EDVWAAHAYENLNYLFSDIHVRGYYPNYAKRYFKENGIKITFVEGDEELLKNNTVDFLSF
SYYMSITQAADPSKYSSGKGNILGGLVNPYLEASDWGWQIDPIGLRLTLNRYYNRYQIPL
FIVENGLGAKDQLVKDEAGGLTVHDDYRIQYMQEHLLQVAEAIQDGVEVMGYTSWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGSGSLTRYRKKSFYWYKEVIQSNGSILSNSSK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttttccagataatttcttatggggaggagcagtagctgcaaaccaagtagaa
ggtgcatataatgagggaggaaaaggattatccgttcaagatgttctccccaatggtgga
ctgggtgaagctacccaagaaccaacggaggataatttgaaattacaagctattgatttt
taccatcgatacaaggaagatatagccctgttttcagagttgggatttaaggtatttaga
acatcaattgcttggagtagaatatttccgaatggagatgaagaatttccaaatgaagaa
gggctacagttttatgatgaactttttgatgaacttctaaagaatggtatagagcctctt
gtaactctttctcactatgaaactcccctgtatctggcaaggaaatatcatggctgggtg
gatagaaaaatgattcaattttttgaaaaatttgctcgtacagtttttgagcgatacaaa
gataaggttaagtactggttgacatttaacgaggtcaattctgtcttagaattgcctttt
acaagtggtggaattgacttgccgaatgaagaactttcaaaacaagatttatatcaggcc
attcaccatgaacttgtagcttctagtcttgttaccaaaattgctcatgaaattattcct
gactgtaaggttggctgtatggtcttagctatgccgacctatccaatgacacccaatcct
gaagatgtttgggcggctcatgcctatgaaaatttgaactatttattttcggatatacat
gttagaggatattatcctaattatgccaaaagatactttaaagaaaatggcataaagatt
actttcgtggaaggtgatgaagagttattaaaaaataatacggttgattttctctccttc
agttattatatgagtattactcaggcagcagatccatcaaaatattcatctggaaaagga
aatatcttgggtggtttggtcaatccttatttagaagcttctgattggggttggcagatt
gatccaattggtttaagattgacactaaatcgttattataatcgataccagattccttta
ttcattgttgaaaatggtttgggagctaaagatcagctagtcaaggatgaggctggtggt
ttgactgttcatgacgattatcgaattcaatacatgcaagaacaccttttacaagttgcg
gaggcgatacaggatggcgtagaagtcatgggttatacttcttggggctgtattgattgt
gtatctatgtctaccgcacaattatctaaaagatatggactaatttatgttgatagaaat
gatgatggaagtggcagtctaactagatatagaaagaaatcattttactggtataaagaa
gttattcaatccaatggcagtatcctgagcaatagctcaaaatag

DBGET integrated database retrieval system